[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpmJ
DDBJ      :rpmJ         putative ribosomal protein L36
Swiss-Prot:RL36_NOCFA   RecName: Full=50S ribosomal protein L36;

Homologs  Archaea  0/68 : Bacteria  304/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
g.42.1
:37 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->37 2hgu8 PDBj 3e-14 78.4 %
:RPS:PDB   1->37 3bbo6 PDBj 5e-07 67.6 %
:HMM:SCOP  1->37 2i2t41 g.42.1.1 * 1.5e-13 67.6 %
:HMM:PFM   1->37 PF00444 * Ribosomal_L36 1.5e-22 70.3 37/38  
:BLT:SWISS 1->37 RL36_NOCFA 1e-18 100.0 %
:PROS 11->36|PS00828|RIBOSOMAL_L36

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55678.1 GT:GENE rpmJ GT:PRODUCT putative ribosomal protein L36 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 928349..928462 GB:FROM 928349 GB:TO 928462 GB:DIRECTION + GB:GENE rpmJ GB:PRODUCT putative ribosomal protein L36 GB:PROTEIN_ID BAD55678.1 LENGTH 37 SQ:AASEQ MKVQPSVKKICEKCKVIRRHGRVMVICDNLRHKQRQG GT:EXON 1|1-37:0| SW:ID RL36_NOCFA SW:DE RecName: Full=50S ribosomal protein L36; SW:GN Name=rpmJ; OrderedLocusNames=NFA_8330; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->37|RL36_NOCFA|1e-18|100.0|37/37| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 11->36|PS00828|RIBOSOMAL_L36|PDOC00650| BL:PDB:NREP 1 BL:PDB:REP 1->37|2hgu8|3e-14|78.4|37/37| RP:PDB:NREP 1 RP:PDB:REP 1->37|3bbo6|5e-07|67.6|37/38| HM:PFM:NREP 1 HM:PFM:REP 1->37|PF00444|1.5e-22|70.3|37/38|Ribosomal_L36| HM:SCP:REP 1->37|2i2t41|1.5e-13|67.6|37/0|g.42.1.1|1/1|Ribosomal protein L36| OP:NHOMO 306 OP:NHOMOORG 305 OP:PATTERN -------------------------------------------------------------------- 11111---------11111-1---1111111111111111111-1111111111111111111111111111-111111111----11-------------------------------------------------------------1---1111111111---1111-111----11-1-1111111-1111111111-1111111111111--111--11111-111111111111-111111111111111111111-1111111111-111111-1111111-11---11-11111111111111111--1111111-11111111111111111111111-11-1-111--111111-1111---1-------------------------------------------------------------------------------------------------------------------------------11111---------------------------------1-111--------------1------------1-----1--111111--------1---------1----------------------11---1--1-----2-----------------------1-1--------------------------------------------------------------------------------------------1----------1-11----------------------------------------------------------11111111-----------------11-------111111111------1---1----------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 37 STR:RPRED 100.0 SQ:SECSTR cccccccccccTTcccEEETTEEEcccccGGGccccc DISOP:02AL 1-4, 32-37| PSIPRED cccccHHHHHHcccEEEEcccEEEEEEcccccccccc //