[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpsC
DDBJ      :rpsC         putative ribosomal protein S3
Swiss-Prot:RS3_NOCFA    RecName: Full=30S ribosomal protein S3;

Homologs  Archaea  39/68 : Bacteria  910/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
d.52.3d.53.1
:267 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->207 1vs5C PDBj 1e-63 54.6 %
:RPS:PDB   1->206 3bbnC PDBj 2e-68 40.5 %
:RPS:SCOP  2->105 1fjgC1  d.52.3.1 * 6e-40 55.8 %
:RPS:SCOP  106->207 1fjgC2  d.53.1.1 * 2e-39 54.5 %
:HMM:SCOP  2->105 1fjgC1 d.52.3.1 * 2.3e-38 54.8 %
:HMM:SCOP  106->207 1fjgC2 d.53.1.1 * 5.4e-37 53.5 %
:RPS:PFM   1->60 PF00417 * Ribosomal_S3_N 4e-14 53.3 %
:RPS:PFM   63->115 PF07650 * KH_2 4e-08 51.1 %
:RPS:PFM   119->202 PF00189 * Ribosomal_S3_C 2e-23 66.3 %
:HMM:PFM   120->202 PF00189 * Ribosomal_S3_C 3.3e-34 56.6 83/85  
:HMM:PFM   1->60 PF00417 * Ribosomal_S3_N 2.5e-24 51.7 60/66  
:HMM:PFM   62->116 PF07650 * KH_2 1.9e-17 53.1 49/59  
:BLT:SWISS 1->267 RS3_NOCFA e-123 100.0 %
:PROS 163->197|PS00548|RIBOSOMAL_S3
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55584.1 GT:GENE rpsC GT:PRODUCT putative ribosomal protein S3 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 797967..798770 GB:FROM 797967 GB:TO 798770 GB:DIRECTION + GB:GENE rpsC GB:PRODUCT putative ribosomal protein S3 GB:PROTEIN_ID BAD55584.1 LENGTH 267 SQ:AASEQ MGQKINPHGFRLGITTDWKSRWYADKQYADYVKEDVAIRKLLATGMERAGISKVEIERTRDRVRVDIHTARPGIVIGRRGAEADRIRAELEKLTGKQVQLNILEVKNPESDAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRSPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELTAASAPAGDRDRPRRERPSRPRRSGSTGTTATSTEAGRAATAVVEAPAENQEG GT:EXON 1|1-267:0| SW:ID RS3_NOCFA SW:DE RecName: Full=30S ribosomal protein S3; SW:GN Name=rpsC; OrderedLocusNames=NFA_7390; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->267|RS3_NOCFA|e-123|100.0|267/267| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 163->197|PS00548|RIBOSOMAL_S3|PDOC00474| SEG 216->256|aasapagdrdrprrerpsrprrsgstgttatsteagraata| BL:PDB:NREP 1 BL:PDB:REP 2->207|1vs5C|1e-63|54.6|205/206| RP:PDB:NREP 1 RP:PDB:REP 1->206|3bbnC|2e-68|40.5|205/217| RP:PFM:NREP 3 RP:PFM:REP 1->60|PF00417|4e-14|53.3|60/68|Ribosomal_S3_N| RP:PFM:REP 63->115|PF07650|4e-08|51.1|47/49|KH_2| RP:PFM:REP 119->202|PF00189|2e-23|66.3|83/84|Ribosomal_S3_C| HM:PFM:NREP 3 HM:PFM:REP 120->202|PF00189|3.3e-34|56.6|83/85|Ribosomal_S3_C| HM:PFM:REP 1->60|PF00417|2.5e-24|51.7|60/66|Ribosomal_S3_N| HM:PFM:REP 62->116|PF07650|1.9e-17|53.1|49/59|KH_2| GO:PFM:NREP 9 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00417|IPR008282| GO:PFM GO:0005622|"GO:intracellular"|PF00417|IPR008282| GO:PFM GO:0005840|"GO:ribosome"|PF00417|IPR008282| GO:PFM GO:0006412|"GO:translation"|PF00417|IPR008282| GO:PFM GO:0003723|"GO:RNA binding"|PF07650|IPR004044| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00189|IPR001351| GO:PFM GO:0005622|"GO:intracellular"|PF00189|IPR001351| GO:PFM GO:0005840|"GO:ribosome"|PF00189|IPR001351| GO:PFM GO:0006412|"GO:translation"|PF00189|IPR001351| RP:SCP:NREP 2 RP:SCP:REP 2->105|1fjgC1|6e-40|55.8|104/105|d.52.3.1| RP:SCP:REP 106->207|1fjgC2|2e-39|54.5|101/101|d.53.1.1| HM:SCP:REP 2->105|1fjgC1|2.3e-38|54.8|104/0|d.52.3.1|1/1|Prokaryotic type KH domain (KH-domain type II)| HM:SCP:REP 106->207|1fjgC2|5.4e-37|53.5|101/101|d.53.1.1|1/1|Ribosomal protein S3 C-terminal domain| OP:NHOMO 963 OP:NHOMOORG 955 OP:PATTERN 11-1-1----------1------1-1111-11-11111111111-11--1111--1111--1111-11 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------124--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 77.2 SQ:SECSTR ccccccTTTccTTTTccccccccccTccHHHHHHHHHHHcccccTTTTTcEEEEEccccccccccEEEEccTTTTccccccTTHHHHHHHHHHccccccccEEEcccTTTcHHHHHHHcTTTTTTTccHHHHHTHHHHHHHTT#cccEEEEEcccccTTcccccccEEEEEcccccccTTcccccEEEccccccccEEEEEEEcccc############################################################ DISOP:02AL 209-267| PSIPRED cccEEcccEEEEcEEccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccEEEEEEEEccccEEEcccccHHHHHHHHHHHHHcccEEEEEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHEEEEEEEEEccccccccccccEEEEEEEEcccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //