[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpsJ
DDBJ      :rpsJ         putative ribosomal protein S10
Swiss-Prot:RS10_RHOSR   RecName: Full=30S ribosomal protein S10;

Homologs  Archaea  49/68 : Bacteria  900/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
d.58.15
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->101 2j00J PDBj 9e-32 56.7 %
:RPS:PDB   4->101 3bbnJ PDBj 9e-32 54.1 %
:RPS:SCOP  5->101 1fjgJ  d.58.15.1 * 4e-32 56.7 %
:HMM:SCOP  5->102 1fjgJ_ d.58.15.1 * 1.5e-33 53.1 %
:RPS:PFM   6->101 PF00338 * Ribosomal_S10 1e-29 70.8 %
:HMM:PFM   6->101 PF00338 * Ribosomal_S10 9.8e-41 54.2 96/97  
:BLT:SWISS 1->101 RS10_RHOSR 4e-55 100.0 %
:PROS 29->44|PS00361|RIBOSOMAL_S10

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55577.1 GT:GENE rpsJ GT:PRODUCT putative ribosomal protein S10 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 794425..794730 GB:FROM 794425 GB:TO 794730 GB:DIRECTION + GB:GENE rpsJ GB:PRODUCT putative ribosomal protein S10 GB:PROTEIN_ID BAD55577.1 LENGTH 101 SQ:AASEQ MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYCVIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ GT:EXON 1|1-101:0| SW:ID RS10_RHOSR SW:DE RecName: Full=30S ribosomal protein S10; SW:GN Name=rpsJ; OrderedLocusNames=RHA1_ro06132; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->101|RS10_RHOSR|4e-55|100.0|101/101| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 29->44|PS00361|RIBOSOMAL_S10|PDOC00312| BL:PDB:NREP 1 BL:PDB:REP 5->101|2j00J|9e-32|56.7|97/98| RP:PDB:NREP 1 RP:PDB:REP 4->101|3bbnJ|9e-32|54.1|98/99| RP:PFM:NREP 1 RP:PFM:REP 6->101|PF00338|1e-29|70.8|96/97|Ribosomal_S10| HM:PFM:NREP 1 HM:PFM:REP 6->101|PF00338|9.8e-41|54.2|96/97|Ribosomal_S10| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00338|IPR001848| GO:PFM GO:0005622|"GO:intracellular"|PF00338|IPR001848| GO:PFM GO:0005840|"GO:ribosome"|PF00338|IPR001848| GO:PFM GO:0006412|"GO:translation"|PF00338|IPR001848| RP:SCP:NREP 1 RP:SCP:REP 5->101|1fjgJ|4e-32|56.7|97/98|d.58.15.1| HM:SCP:REP 5->102|1fjgJ_|1.5e-33|53.1|98/0|d.58.15.1|1/1|Ribosomal protein S10| OP:NHOMO 1000 OP:NHOMOORG 982 OP:PATTERN 11-1-1-111111111111-1-111111-111-1-11--1--1111111----111111111111--- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111121111111111111111111111111111-111111111111-2-111111111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111-111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 -----1-----------------------------------------------------------1111-11---111111-----------------------12----------------------------------------------------------------3---111117111113123-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 100.0 SQ:SECSTR ccccccEEEEEEccHHHHHHHTTHHHHTTTTTcccEEEEEEcccEEEEEcccccccccccccccEEEEEEEEEEEEccccHHHHHHHTTcccccccEEEEE DISOP:02AL 1-3| PSIPRED ccccEEEEEEEEEcHHHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEEEEcccccccccHHHHEEEEEEEEEEEEcccHHHHHHHHccccccccEEEEc //