[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpsK
DDBJ      :rpsK         putative ribosomal protein S11
Swiss-Prot:RS11_NOCFA   RecName: Full=30S ribosomal protein S11;

Homologs  Archaea  36/68 : Bacteria  906/915 : Eukaryota  163/199 : Viruses  0/175   --->[See Alignment]
c.55.4
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->137 1vs5K PDBj 5e-41 61.5 %
:RPS:PDB   21->134 2e5lK PDBj 5e-44 60.5 %
:RPS:SCOP  21->136 1fjgK  c.55.4.1 * 2e-45 60.3 %
:HMM:SCOP  21->137 1fjgK_ c.55.4.1 * 6.2e-47 66.7 %
:RPS:PFM   29->136 PF00411 * Ribosomal_S11 1e-35 72.2 %
:HMM:PFM   27->136 PF00411 * Ribosomal_S11 1.8e-51 56.4 110/110  
:BLT:SWISS 1->137 RS11_NOCFA 7e-78 100.0 %
:PROS 105->127|PS00054|RIBOSOMAL_S11

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55680.1 GT:GENE rpsK GT:PRODUCT putative ribosomal protein S11 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 929062..929475 GB:FROM 929062 GB:TO 929475 GB:DIRECTION + GB:GENE rpsK GB:PRODUCT putative ribosomal protein S11 GB:PROTEIN_ID BAD55680.1 LENGTH 137 SQ:AASEQ MPPKSRASGPKKTQKSRRRDKKNVPHGNAHIKSTFNNTIVSITDPNGNVISWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDVTPQPHNGCRPPKRRRV GT:EXON 1|1-137:0| SW:ID RS11_NOCFA SW:DE RecName: Full=30S ribosomal protein S11; SW:GN Name=rpsK; OrderedLocusNames=NFA_8350; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->137|RS11_NOCFA|7e-78|100.0|137/137| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 105->127|PS00054|RIBOSOMAL_S11|PDOC00053| BL:PDB:NREP 1 BL:PDB:REP 21->137|1vs5K|5e-41|61.5|117/117| RP:PDB:NREP 1 RP:PDB:REP 21->134|2e5lK|5e-44|60.5|114/115| RP:PFM:NREP 1 RP:PFM:REP 29->136|PF00411|1e-35|72.2|108/109|Ribosomal_S11| HM:PFM:NREP 1 HM:PFM:REP 27->136|PF00411|1.8e-51|56.4|110/110|Ribosomal_S11| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00411|IPR001971| GO:PFM GO:0005622|"GO:intracellular"|PF00411|IPR001971| GO:PFM GO:0005840|"GO:ribosome"|PF00411|IPR001971| GO:PFM GO:0006412|"GO:translation"|PF00411|IPR001971| RP:SCP:NREP 1 RP:SCP:REP 21->136|1fjgK|2e-45|60.3|116/119|c.55.4.1| HM:SCP:REP 21->137|1fjgK_|6.2e-47|66.7|117/0|c.55.4.1|1/1|Translational machinery components| OP:NHOMO 1230 OP:NHOMOORG 1105 OP:PATTERN --------11111111--------1-11111111--1-111111-111-1111-----1--111-1-- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111--1--111111111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ---11111411-222-11111111111111111111111111111111111111111111111-1--1-----11-------111----1211211------1131112123322322-1122155-5-696-326121122141-11112112132221113122-11112223313191111325781431111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 88.3 SQ:SECSTR ################cTTcccccccEEEEEEccccccEEEEEcTTccEEEEEccTTTTcccGGGGcHHHHHHHHHHHHHTTGGGTccEEEEEEEcccccHHHHHHHHHHHTcEEEEEEEccccccccccccccccc DISOP:02AL 1-23, 133-137| PSIPRED cccccccccccccccccccEEcEEcccEEEEEEEcccEEEEEEcccccEEEEEEcccccEEccccccHHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHccEEEEEEEEccccccccccccccccc //