[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpsM
DDBJ      :rpsM         putative ribosomal protein S13
Swiss-Prot:RS13_NOCFA   RecName: Full=30S ribosomal protein S13;

Homologs  Archaea  0/68 : Bacteria  906/915 : Eukaryota  48/199 : Viruses  0/175   --->[See Alignment]
a.156.1
:123 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->111 2uuaM PDBj 5e-33 56.9 %
:RPS:PDB   2->111 2e5lM PDBj 7e-21 56.9 %
:RPS:SCOP  2->111 1fjgM  a.156.1.1 * 1e-21 56.9 %
:HMM:SCOP  2->122 1fjgM_ a.156.1.1 * 1.1e-43 55.8 %
:RPS:PFM   3->110 PF00416 * Ribosomal_S13 1e-21 55.1 %
:HMM:PFM   3->110 PF00416 * Ribosomal_S13 4.9e-41 46.2 106/106  
:BLT:SWISS 1->111 RS13_NOCFA 3e-48 100.0 %
:PROS 89->102|PS00646|RIBOSOMAL_S13_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55679.1 GT:GENE rpsM GT:PRODUCT putative ribosomal protein S13 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 928683..929054 GB:FROM 928683 GB:TO 929054 GB:DIRECTION + GB:GENE rpsM GB:PRODUCT putative ribosomal protein S13 GB:PROTEIN_ID BAD55679.1 LENGTH 123 SQ:AASEQ MARLMGVDLPREKRMEIALTYIYGIGRTRSKEILEATGVSPDLRSKDLSDDDLTKLRDYIEASEFKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKKTVAGKKK GT:EXON 1|1-123:0| SW:ID RS13_NOCFA SW:DE RecName: Full=30S ribosomal protein S13; SW:GN Name=rpsM; OrderedLocusNames=NFA_8340; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->111|RS13_NOCFA|3e-48|100.0|111/123| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 89->102|PS00646|RIBOSOMAL_S13_1|PDOC00556| SEG 42->58|dlrskdlsdddltklrd| SEG 112->122|kgpkktvagkk| BL:PDB:NREP 1 BL:PDB:REP 2->111|2uuaM|5e-33|56.9|109/125| RP:PDB:NREP 1 RP:PDB:REP 2->111|2e5lM|7e-21|56.9|109/122| RP:PFM:NREP 1 RP:PFM:REP 3->110|PF00416|1e-21|55.1|107/107|Ribosomal_S13| HM:PFM:NREP 1 HM:PFM:REP 3->110|PF00416|4.9e-41|46.2|106/106|Ribosomal_S13| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF00416|IPR001892| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00416|IPR001892| GO:PFM GO:0005622|"GO:intracellular"|PF00416|IPR001892| GO:PFM GO:0005840|"GO:ribosome"|PF00416|IPR001892| GO:PFM GO:0006412|"GO:translation"|PF00416|IPR001892| RP:SCP:NREP 1 RP:SCP:REP 2->111|1fjgM|1e-21|56.9|109/125|a.156.1.1| HM:SCP:REP 2->122|1fjgM_|1.1e-43|55.8|120/125|a.156.1.1|1/1|S13-like H2TH domain| OP:NHOMO 977 OP:NHOMOORG 954 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-1111111111111111111111111111-1111111111111111111111111111-1111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------111--1-111---------------111111-------1--------11--1------11--1-1111-1111--1-----------1---1-1----------------------------------------------------1----------------1111E111113--3122------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 90.2 SQ:SECSTR GcccTTTcccccccHHHHGGGcTTccTTTTGGGTTTTcccTTccGGGccHHHHHHHHHHHHTTHcccHHHHHHHHHHHHHHHHHTTcHHHHHHHHTccccccccccccHHH############ DISOP:02AL 114-123| PSIPRED cEEEEcEEccccEEEEEEEEHHHcccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHcccccccccEEccccccccccccccccccc //