[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpsN
DDBJ      :rpsN         putative ribosomal protein S14
Swiss-Prot:RS14Z_NOCFA  RecName: Full=30S ribosomal protein S14 type Z;

Homologs  Archaea  0/68 : Bacteria  485/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.39.1
:61 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->61 2j00N PDBj 3e-24 71.7 %
:RPS:PDB   9->61 3bbnN PDBj 1e-15 39.6 %
:RPS:SCOP  2->61 1fjgN  g.39.1.7 * 3e-21 71.7 %
:HMM:SCOP  2->61 1fjgN_ g.39.1.7 * 1.4e-21 46.7 %
:RPS:PFM   19->60 PF00253 * Ribosomal_S14 2e-10 61.9 %
:HMM:PFM   10->60 PF00253 * Ribosomal_S14 2.9e-26 47.1 51/55  
:BLT:SWISS 1->61 RS14Z_NOCFA 2e-34 100.0 %
:PROS 23->45|PS00527|RIBOSOMAL_S14

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55622.1 GT:GENE rpsN GT:PRODUCT putative ribosomal protein S14 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 847282..847467 GB:FROM 847282 GB:TO 847467 GB:DIRECTION + GB:GENE rpsN GB:PRODUCT putative ribosomal protein S14 GB:PROTEIN_ID BAD55622.1 LENGTH 61 SQ:AASEQ MAKKALVNKANRKPKFAVRAYTRCQRCGRPHAVYRKFGLCRVCLRDMAHKGELPGVHKSSW GT:EXON 1|1-61:0| SW:ID RS14Z_NOCFA SW:DE RecName: Full=30S ribosomal protein S14 type Z; SW:GN Name=rpsZ; Synonyms=rpsN; OrderedLocusNames=NFA_7770; SW:KW Complete proteome; Metal-binding; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->61|RS14Z_NOCFA|2e-34|100.0|61/61| GO:SWS:NREP 5 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 23->45|PS00527|RIBOSOMAL_S14|PDOC00456| BL:PDB:NREP 1 BL:PDB:REP 2->61|2j00N|3e-24|71.7|60/60| RP:PDB:NREP 1 RP:PDB:REP 9->61|3bbnN|1e-15|39.6|53/99| RP:PFM:NREP 1 RP:PFM:REP 19->60|PF00253|2e-10|61.9|42/55|Ribosomal_S14| HM:PFM:NREP 1 HM:PFM:REP 10->60|PF00253|2.9e-26|47.1|51/55|Ribosomal_S14| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00253|IPR001209| GO:PFM GO:0005622|"GO:intracellular"|PF00253|IPR001209| GO:PFM GO:0005840|"GO:ribosome"|PF00253|IPR001209| GO:PFM GO:0006412|"GO:translation"|PF00253|IPR001209| RP:SCP:NREP 1 RP:SCP:REP 2->61|1fjgN|3e-21|71.7|60/60|g.39.1.7| HM:SCP:REP 2->61|1fjgN_|1.4e-21|46.7|60/60|g.39.1.7|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 520 OP:NHOMOORG 485 OP:PATTERN -------------------------------------------------------------------- 11111-11---11111111-12111111111121112222111111111------1----1111111111111111111111111111-------------------11----------------------------11111111----1---11111111111111----11111111111111111111111111111111111111112211111111111122222211111111111111111111121-112112-21112221-11---11111111111111111111111122222222212221--1111111111111111111111111111111-11111-111111-1111111111---11---------------------------------------------------------------1-11111111---------1111-11-------------------------1111--1111--------------------------------------------------------------------11--1111-11111111-1111111111111111111111111111--111111-1-11111-----1--------------------------1----111111-11111----------------------------------1111-1-11111111111111--------11------------1--111111111111--1111111-11-11111----------11-------------1---1111111111------------------------------1-1-12111111111111-----1-111-1111111-111111111111111111-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 98.4 SQ:SECSTR #ccHHHHHccccccccGGGcccccccccccccccTTTcccTTHHHHHHTTTcccccccccc DISOP:02AL 1-2, 8-17| PSIPRED ccHHHHHHHHHHccccccEEEEcEEccccccEEEccccccHHHHHHHHHcccccccEEccc //