[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpsQ
DDBJ      :rpsQ         putative ribosomal protein S17
Swiss-Prot:RS17_NOCFA   RecName: Full=30S ribosomal protein S17;

Homologs  Archaea  0/68 : Bacteria  867/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:89 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->88 1ripA PDBj 1e-24 64.6 %
:RPS:PDB   11->89 3d5aQ PDBj 4e-23 45.6 %
:RPS:SCOP  10->88 1vs5Q1  b.40.4.5 * 1e-24 55.7 %
:HMM:SCOP  10->88 1fjgQ_ b.40.4.5 * 1.3e-28 58.2 %
:RPS:PFM   16->84 PF00366 * Ribosomal_S17 4e-14 59.4 %
:HMM:PFM   16->84 PF00366 * Ribosomal_S17 1.4e-31 55.1 69/69  
:BLT:SWISS 1->89 RS17_NOCFA 9e-47 100.0 %
:PROS 62->74|PS00056|RIBOSOMAL_S17

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55587.1 GT:GENE rpsQ GT:PRODUCT putative ribosomal protein S17 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 799426..799695 GB:FROM 799426 GB:TO 799695 GB:DIRECTION + GB:GENE rpsQ GB:PRODUCT putative ribosomal protein S17 GB:PROTEIN_ID BAD55587.1 LENGTH 89 SQ:AASEQ MSEKTVERGRRKVRIGYVVSDKMNKTIVVELEDRVKHPLYGKIIRTTSKVKAHDENEIAGVGDRVQLMETRPLSATKRWRLVEVLEKAK GT:EXON 1|1-89:0| SW:ID RS17_NOCFA SW:DE RecName: Full=30S ribosomal protein S17; SW:GN Name=rpsQ; OrderedLocusNames=NFA_7420; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->89|RS17_NOCFA|9e-47|100.0|89/89| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 62->74|PS00056|RIBOSOMAL_S17|PDOC00055| BL:PDB:NREP 1 BL:PDB:REP 10->88|1ripA|1e-24|64.6|79/81| RP:PDB:NREP 1 RP:PDB:REP 11->89|3d5aQ|4e-23|45.6|79/99| RP:PFM:NREP 1 RP:PFM:REP 16->84|PF00366|4e-14|59.4|69/69|Ribosomal_S17| HM:PFM:NREP 1 HM:PFM:REP 16->84|PF00366|1.4e-31|55.1|69/69|Ribosomal_S17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00366|IPR000266| GO:PFM GO:0005622|"GO:intracellular"|PF00366|IPR000266| GO:PFM GO:0005840|"GO:ribosome"|PF00366|IPR000266| GO:PFM GO:0006412|"GO:translation"|PF00366|IPR000266| RP:SCP:NREP 1 RP:SCP:REP 10->88|1vs5Q1|1e-24|55.7|79/80|b.40.4.5| HM:SCP:REP 10->88|1fjgQ_|1.3e-28|58.2|79/104|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 897 OP:NHOMOORG 882 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111112-1--111111111111111111111111-11111111111112-1111111111-11111111111111111111111111111---1--11--111111111111111-1---1--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------1--------1-11111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111-1111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ---------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------11--7111221112-21------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 89.9 SQ:SECSTR #########cccEEEEEEEEcccccEEEEEEEEEEEcTTTccEEEEEEEEEEEcTTccccTTcEEEEEEEEEEETTEEEEEEEEEEccc DISOP:02AL 1-11| PSIPRED ccccHHHHcccEEEEEEEEEcccccEEEEEEEEEEEcccccEEEEEEccEEEEccccEEccccEEEEEEccccccEEEEEEEEEEEccc //