[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpsS
DDBJ      :rpsS         putative ribosomal protein S19
Swiss-Prot:RS19_NOCFA   RecName: Full=30S ribosomal protein S19;

Homologs  Archaea  8/68 : Bacteria  902/915 : Eukaryota  80/199 : Viruses  0/175   --->[See Alignment]
d.28.1
:93 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->86 1ibmS PDBj 2e-33 69.4 %
:RPS:PDB   1->92 3bbnS PDBj 8e-32 57.6 %
:RPS:SCOP  2->85 1fjgS  d.28.1.1 * 2e-31 69.0 %
:HMM:SCOP  2->85 1fjgS_ d.28.1.1 * 3.3e-32 56.0 %
:RPS:PFM   3->83 PF00203 * Ribosomal_S19 3e-25 66.7 %
:HMM:PFM   3->83 PF00203 * Ribosomal_S19 1.4e-38 60.5 81/81  
:BLT:SWISS 1->93 RS19_NOCFA 2e-52 100.0 %
:PROS 53->77|PS00323|RIBOSOMAL_S19

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55582.1 GT:GENE rpsS GT:PRODUCT putative ribosomal protein S19 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 797287..797568 GB:FROM 797287 GB:TO 797568 GB:DIRECTION + GB:GENE rpsS GB:PRODUCT putative ribosomal protein S19 GB:PROTEIN_ID BAD55582.1 LENGTH 93 SQ:AASEQ MPRSLKKGPFVDDHLQAKVDVQNEKGTKQVIKTWSRRSTITPDFIGHTFAVHDGRKHVPVFVSENMVGHKLGEFAPTRTFKSHVKEDRKSKRR GT:EXON 1|1-93:0| SW:ID RS19_NOCFA SW:DE RecName: Full=30S ribosomal protein S19; SW:GN Name=rpsS; OrderedLocusNames=NFA_7370; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->93|RS19_NOCFA|2e-52|100.0|93/93| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 53->77|PS00323|RIBOSOMAL_S19|PDOC00288| BL:PDB:NREP 1 BL:PDB:REP 2->86|1ibmS|2e-33|69.4|85/87| RP:PDB:NREP 1 RP:PDB:REP 1->92|3bbnS|8e-32|57.6|92/92| RP:PFM:NREP 1 RP:PFM:REP 3->83|PF00203|3e-25|66.7|81/81|Ribosomal_S19| HM:PFM:NREP 1 HM:PFM:REP 3->83|PF00203|1.4e-38|60.5|81/81|Ribosomal_S19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00203|IPR002222| GO:PFM GO:0005622|"GO:intracellular"|PF00203|IPR002222| GO:PFM GO:0005840|"GO:ribosome"|PF00203|IPR002222| GO:PFM GO:0006412|"GO:translation"|PF00203|IPR002222| RP:SCP:NREP 1 RP:SCP:REP 2->85|1fjgS|2e-31|69.0|84/84|d.28.1.1| HM:SCP:REP 2->85|1fjgS_|3.3e-32|56.0|84/84|d.28.1.1|1/1|Ribosomal protein S19| OP:NHOMO 1006 OP:NHOMOORG 990 OP:PATTERN --1-11-----------------------1---1----------------11------------1--- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-111111111111111-111111111111-1111111111111111111111111111111111111111111111111-11111-11111111111111111111-111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------11-111-1-11----1-----111-111111---111111-1-11-111111-1111-111111111111111111-111111411111-1111--------------------------------------------------------------------1111--------1-9112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 98.9 SQ:SECSTR ccccccccccccHHHHHHHHTTTTTTccccEEEccccccccTTcTTccEEEEccccEEEEcccccccccccTTTcccccccccccccccccc# DISOP:02AL 81-93| PSIPRED ccccccccccccHHHHHHHHHHHHcccccEEEEEEccccccHHHcccEEEEEcccEEEEEEEccccccEEcccEEcccccccccccccccccc //