[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : rpsT
DDBJ      :rpsT         putative ribosomal protein S20
Swiss-Prot:RS20_NOCFA   RecName: Full=30S ribosomal protein S20;

Homologs  Archaea  0/68 : Bacteria  169/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.7.6
:86 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->86 1vs5T PDBj 9e-09 35.7 %
:RPS:SCOP  3->86 1vs5T1  a.7.6.1 * 1e-09 35.7 %
:HMM:SCOP  3->86 1fjgT_ a.7.6.1 * 5.5e-25 60.7 %
:HMM:PFM   2->85 PF01649 * Ribosomal_S20p 3.3e-30 58.3 84/84  
:BLT:SWISS 1->86 RS20_NOCFA 4e-34 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56241.1 GT:GENE rpsT GT:PRODUCT putative ribosomal protein S20 GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1568714..1568974) GB:FROM 1568714 GB:TO 1568974 GB:DIRECTION - GB:GENE rpsT GB:PRODUCT putative ribosomal protein S20 GB:PROTEIN_ID BAD56241.1 LENGTH 86 SQ:AASEQ MANIKSQMKRIRTNEAARKRNQSVKSALRTAIRSFREAAEAGDKDKAAERLQFASRKLDKAASKGVIHPNQAANKKSALALAFNKL GT:EXON 1|1-86:0| SW:ID RS20_NOCFA SW:DE RecName: Full=30S ribosomal protein S20; SW:GN Name=rpsT; OrderedLocusNames=NFA_13960; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->86|RS20_NOCFA|4e-34|100.0|86/86| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 37->49|eaaeagdkdkaae| BL:PDB:NREP 1 BL:PDB:REP 3->86|1vs5T|9e-09|35.7|84/85| HM:PFM:NREP 1 HM:PFM:REP 2->85|PF01649|3.3e-30|58.3|84/84|Ribosomal_S20p| RP:SCP:NREP 1 RP:SCP:REP 3->86|1vs5T1|1e-09|35.7|84/85|a.7.6.1| HM:SCP:REP 3->86|1fjgT_|5.5e-25|60.7|84/99|a.7.6.1|1/1|Ribosomal protein S20| OP:NHOMO 169 OP:NHOMOORG 169 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11111111111111111111-11111111111111111111111111111111111111111------------------1------------------------------------------------------11----------------------------------11111111111111111111--11111111-1111111111-----------------11-1-1-1--1------------1----11---1111--------------1111111111111---------1-11--1111111-1-----1-------1-1--111111---11--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1----------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 97.7 SQ:SECSTR ##cccTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHTTGGGcccccTTHHHHHHHHHHHHHHTT DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcc //