[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : sdhC
DDBJ      :sdhC         putative succinate dehydrogenase cytochrome b subunit
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.21.2
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->94 2wdrC PDBj 1e-04 30.3 %
:RPS:SCOP  14->119 1nekC  f.21.2.2 * 1e-22 20.8 %
:HMM:SCOP  2->125 1nekC_ f.21.2.2 * 5.2e-26 29.3 %
:RPS:PFM   15->115 PF01127 * Sdh_cyt 3e-09 37.0 %
:HMM:PFM   7->116 PF01127 * Sdh_cyt 4.6e-27 31.2 109/121  
:BLT:SWISS 21->93 DHSD_NATPH 1e-11 35.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55794.1 GT:GENE sdhC GT:PRODUCT putative succinate dehydrogenase cytochrome b subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1051058..1051456) GB:FROM 1051058 GB:TO 1051456 GB:DIRECTION - GB:GENE sdhC GB:PRODUCT putative succinate dehydrogenase cytochrome b subunit GB:PROTEIN_ID BAD55794.1 LENGTH 132 SQ:AASEQ MTTIEAPAQPKRKTLYRGDPGMWSWALHRITGVTIFFFLFVHVLDTALVRVSPEVYDEAIETYKNPLVALMEMGLVVCVLFHALNGVRVILVDFWSQGPRFQRQMLWIVLAIWIVASAAGVGRQFFYLLTEH GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 21->93|DHSD_NATPH|1e-11|35.6|73/130| TM:NTM 3 TM:REGION 32->54| TM:REGION 70->92| TM:REGION 101->123| BL:PDB:NREP 1 BL:PDB:REP 27->94|2wdrC|1e-04|30.3|66/122| RP:PFM:NREP 1 RP:PFM:REP 15->115|PF01127|3e-09|37.0|100/120|Sdh_cyt| HM:PFM:NREP 1 HM:PFM:REP 7->116|PF01127|4.6e-27|31.2|109/121|Sdh_cyt| GO:PFM:NREP 1 GO:PFM GO:0016627|"GO:oxidoreductase activity, acting on the CH-CH group of donors"|PF01127|IPR000701| RP:SCP:NREP 1 RP:SCP:REP 14->119|1nekC|1e-22|20.8|106/129|f.21.2.2| HM:SCP:REP 2->125|1nekC_|5.2e-26|29.3|123/129|f.21.2.2|1/1|Fumarate reductase respiratory complex transmembrane subunits| OP:NHOMO 67 OP:NHOMOORG 64 OP:PATTERN -------------------------11--1-1------------------------------------ ---11---------11111-31111111111111111121-11-111-1111111111------111111--------------------------------------1---------------------1---11---------1-------------------------------------11111-------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 66 STR:RPRED 50.0 SQ:SECSTR ##########################HHHHHHHHHHHHHHHHHHHHHHH##cHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHT###################################### DISOP:02AL 1-16| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //