[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : sdhD
DDBJ      :sdhD         putative succinate dehydrogenase membrane subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.21.2
:143 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  33->138 1nekD  f.21.2.2 * 2e-17 21.9 %
:HMM:SCOP  28->140 2bs2C1 f.21.2.1 * 5.4e-27 30.9 %
:HMM:PFM   18->125 PF01127 * Sdh_cyt 9.9e-19 22.8 101/121  
:BLT:SWISS 31->105 DHSD_ARCFU 3e-06 34.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55793.1 GT:GENE sdhD GT:PRODUCT putative succinate dehydrogenase membrane subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1050621..1051052) GB:FROM 1050621 GB:TO 1051052 GB:DIRECTION - GB:GENE sdhD GB:PRODUCT putative succinate dehydrogenase membrane subunit GB:PROTEIN_ID BAD55793.1 LENGTH 143 SQ:AASEQ MTAPVLGKSYDRPASLDLPRAPRGRAGNNFEKYAWLFMRFSGLLLIVLVLGHMFIMLMIDGGVQRLNFAFVAGRWASPFWQIWDLTMLWLAQLHGGNGLRTVIDDYSRKDSTRFWLKTLLAVSMILIMGVGTYVIFTFDPNIS GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 31->105|DHSD_ARCFU|3e-06|34.2|73/117| TM:NTM 3 TM:REGION 38->60| TM:REGION 69->91| TM:REGION 116->138| HM:PFM:NREP 1 HM:PFM:REP 18->125|PF01127|9.9e-19|22.8|101/121|Sdh_cyt| RP:SCP:NREP 1 RP:SCP:REP 33->138|1nekD|2e-17|21.9|96/113|f.21.2.2| HM:SCP:REP 28->140|2bs2C1|5.4e-27|30.9|110/0|f.21.2.1|1/1|Fumarate reductase respiratory complex transmembrane subunits| OP:NHOMO 56 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- ---11---------11111-31111111111111111111-11-111-1111111111------111111---------------------------------------------------------------------------1-------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-28| PSIPRED cccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //