[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : sms
DDBJ      :sms          putative DNA repair protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  837/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
c.37.1d.14.1g.41.5
:462 amino acids
:PSIPRED
:DISOPRED
:RPS:PDB   1->35 2crcA PDBj 2e-07 11.4 %
:RPS:PDB   73->299 3dvlD PDBj 5e-28 18.6 %
:RPS:SCOP  1->36 1b71A2  g.41.5.1 * 6e-09 19.4 %
:RPS:SCOP  72->280 1tf7A1  c.37.1.11 * 2e-20 16.7 %
:RPS:SCOP  289->457 1xhkA  d.14.1.10 * 5e-16 15.6 %
:HMM:SCOP  72->273 1ubeA1 c.37.1.11 * 5.8e-48 42.2 %
:HMM:SCOP  254->452 1xhkA_ d.14.1.10 * 1.3e-32 33.7 %
:RPS:PFM   73->263 PF06745 * KaiC 2e-31 49.7 %
:HMM:PFM   72->142 PF06745 * KaiC 6.6e-16 42.3 71/226  
:HMM:PFM   162->253 PF06745 * KaiC 0.00069 20.2 84/226  
:HMM:PFM   366->429 PF05362 * Lon_C 4.2e-06 28.1 64/205  
:BLT:SWISS 1->430 RADA_MYCTU e-119 55.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55274.1 GT:GENE sms GT:PRODUCT putative DNA repair protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(448069..449457) GB:FROM 448069 GB:TO 449457 GB:DIRECTION - GB:GENE sms GB:PRODUCT putative DNA repair protein GB:PROTEIN_ID BAD55274.1 LENGTH 462 SQ:AASEQ MAKTKAIFRCSACSHEVAKWVGKCPDCGAWGTVDEVAVSAGAPGAPGRRAMLPSTAAAPISAIDSQVTKARPTGVSELDRVLGGGVVAGSVVLLSGEPGVGKSTLLLEVAHQWARRPGEKALYVTAEESAGQVRLRADRTGAVHEQVFLAAESDLSIVLGHVEQVRPTLLVVDSVQTMLAPEAEGVIGGVTQVRAVTAALTSLAKASGIAVLLVGHVTKDGNVAGPRTLEHLVDVVLQFEGDKNSTLRMVRGIKNRFGSADEVGCFELHEDGIACVDDPSGLFLHHRTDPVPGTAVTVAMDGKRPLVGEVQGLTVKTEIPAPRRAVSGLDYNRVAMVLAVLQSRGRVFLGKHDVYAATVGGMRLAEPAADLAIALAIASAECDTALPAGWVILGEVGLAGEVRKVTGVARRLAEAERLGFTTALVPPGSERLKGATIRVHEVGDVRSALRISGLRGRKSGGD GT:EXON 1|1-462:0| BL:SWS:NREP 1 BL:SWS:REP 1->430|RADA_MYCTU|e-119|55.1|428/480| SEG 40->50|agapgapgrra| SEG 81->96|vlgggvvagsvvllsg| SEG 364->381|laepaadlaialaiasae| RP:PDB:NREP 2 RP:PDB:REP 1->35|2crcA|2e-07|11.4|35/52| RP:PDB:REP 73->299|3dvlD|5e-28|18.6|215/483| RP:PFM:NREP 1 RP:PFM:REP 73->263|PF06745|2e-31|49.7|183/202|KaiC| HM:PFM:NREP 3 HM:PFM:REP 72->142|PF06745|6.6e-16|42.3|71/226|KaiC| HM:PFM:REP 162->253|PF06745|0.00069|20.2|84/226|KaiC| HM:PFM:REP 366->429|PF05362|4.2e-06|28.1|64/205|Lon_C| RP:SCP:NREP 3 RP:SCP:REP 1->36|1b71A2|6e-09|19.4|36/44|g.41.5.1| RP:SCP:REP 72->280|1tf7A1|2e-20|16.7|203/242|c.37.1.11| RP:SCP:REP 289->457|1xhkA|5e-16|15.6|167/185|d.14.1.10| HM:SCP:REP 72->273|1ubeA1|5.8e-48|42.2|199/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 254->452|1xhkA_|1.3e-32|33.7|166/0|d.14.1.10|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 872 OP:NHOMOORG 858 OP:PATTERN --------------------------------------------1----------------------- ----11111111-111111-11--1111111-11111111111111-11111111111--111111111111111111----111111111111111--11111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111-11111--1111111111111111-11-111111111111111111111111111111111111111121111111111211111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111--11111111-----1-111--------------------------1111111111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1---7111111121-14112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 36-67, 183-192, 280-292, 453-462| PSIPRED cccccEEEEEcccccccccccEEccccccccHHHHHHHHccccHHHHHHHHcccccEEEEcccccccccccccccHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHccccHHHHHEEHHHHHHHHHHHHHHccccEEEEcccHHHccHHHcccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEccccccccccHHHHHHEEEEEEcccccEEEEEEEEEcccccccEEEEEEEcccccEEccccccccccccccccccEEEEEEEEcccEEEEEEEEEEEcccccccEEEEEEccHHHHHHHHHHHHHHccccHHHcEEEEEcccccEEccccccHHHHHHHHHHHHcccccccEEEEEEEEcccEEEEccHHHHHHHHHHHccccEEEEcHHHHHHHHcccEEEEEccHHHHHHHHcccccccccc //