[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : sucB
DDBJ      :sucB         putative dihydrolipoamide succinyltransferase
Swiss-Prot:ODO2_MYCTU   RecName: Full=Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex;         Short=E2;         EC=2.3.1.61;AltName: Full=Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex;

Homologs  Archaea  22/68 : Bacteria  777/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
a.9.1b.84.1c.43.1
:587 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->60 1labA PDBj 9e-10 40.7 %
:BLT:PDB   135->202 1labA PDBj 6e-12 42.6 %
:BLT:PDB   283->315 1w4hA PDBj 3e-06 48.5 %
:BLT:PDB   356->578 1sczA PDBj 2e-38 39.4 %
:RPS:PDB   5->62 2dneA PDBj 9e-11 32.8 %
:RPS:PDB   131->205 3bg5A PDBj 8e-14 30.7 %
:RPS:PDB   276->316 1balA PDBj 2e-11 39.0 %
:RPS:PDB   352->578 1c4tA PDBj 2e-64 38.6 %
:RPS:SCOP  1->62 1y8nB1  b.84.1.1 * 1e-13 33.9 %
:RPS:SCOP  131->202 1y8nB1  b.84.1.1 * 5e-15 31.9 %
:RPS:SCOP  276->316 1balA  a.9.1.1 * 3e-12 39.0 %
:RPS:SCOP  352->577 1c4tA  c.43.1.1 * 5e-69 38.8 %
:HMM:SCOP  1->98 1y8oB1 b.84.1.1 * 5e-28 52.0 %
:HMM:SCOP  127->227 1y8oB1 b.84.1.1 * 2.9e-26 46.5 %
:HMM:SCOP  272->322 1balA_ a.9.1.1 * 3.4e-13 54.9 %
:HMM:SCOP  336->578 1eafA_ c.43.1.1 * 2.6e-78 48.9 %
:RPS:PFM   4->62 PF00364 * Biotin_lipoyl 8e-09 40.7 %
:RPS:PFM   134->205 PF00364 * Biotin_lipoyl 2e-11 44.4 %
:RPS:PFM   284->316 PF02817 * E3_binding 3e-07 66.7 %
:RPS:PFM   356->578 PF00198 * 2-oxoacid_dh 3e-48 47.5 %
:HMM:PFM   351->579 PF00198 * 2-oxoacid_dh 1.1e-77 46.8 222/231  
:HMM:PFM   5->76 PF00364 * Biotin_lipoyl 6e-26 44.4 72/74  
:HMM:PFM   133->205 PF00364 * Biotin_lipoyl 1.8e-24 45.2 73/74  
:HMM:PFM   281->317 PF02817 * E3_binding 6.6e-20 54.1 37/39  
:HMM:PFM   216->257 PF05887 * Trypan_PARP 3.9e-07 47.6 42/143  
:BLT:SWISS 1->62,133->206,282->587 ODO2_MYCTU e-108 82.7 %
:PROS 27->56|PS00189|LIPOYL
:PROS 156->185|PS00189|LIPOYL
:REPEAT 2|5->62|134->191
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56536.1 GT:GENE sucB GT:PRODUCT putative dihydrolipoamide succinyltransferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1841712..1843475) GB:FROM 1841712 GB:TO 1843475 GB:DIRECTION - GB:GENE sucB GB:PRODUCT putative dihydrolipoamide succinyltransferase GB:PROTEIN_ID BAD56536.1 LENGTH 587 SQ:AASEQ MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLSKIVAQEDDVVEVGGELGVISEAGEAPAESAPAPEAPAAEAPAEESAAAEPEPEPAQAEQAPAQQPAASGDAAEGTPVQMPALGESVTEGTVTRWLKSVGDQVEVDEPLLEVSTDKVDTEIPAPVAGTLLEITAQEDDVVAVGGQLGVIGSGKPAAASAPAPAPAPETKAEPKPEPAPEPKPEPAPEPKPEPKPEPAPAPKAEQPAPAAQAQPQAPAPADSGATPYVTPLVRKLAEEHGVDLNSIKGSGVGGRIRKQDVLAAAEAKKAPAAAAAPAAKAPSAPAPAPQLAHLRGTTQKASRIRQITATKTRESLQTTAQLTQVHEADVTKIAALRAQAKAAFKEREGVNLTFLPFFAKAVVEALGVHPNVNASYNEDTKEITYHASVHLGIAVDTEQGLLSPVIHNASDLSLAGLARAIADIADRARNGGLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPVVVTDETGGESIGVRSMCYLPLTYDHRLIDGADAGRFLTTIRHRLEEAAFEADLGL GT:EXON 1|1-587:0| SW:ID ODO2_MYCTU SW:DE RecName: Full=Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex; Short=E2; EC=2.3.1.61;AltName: Full=Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex; SW:GN Name=sucB; OrderedLocusNames=Rv2215, MT2272; ORFNames=MTCY190.26; SW:KW Acyltransferase; Complete proteome; Lipoyl; Repeat; Transferase;Tricarboxylic acid cycle. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->62,133->206,282->587|ODO2_MYCTU|e-108|82.7|442/553| GO:SWS:NREP 4 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0031405|"GO:lipoic acid binding"|Lipoyl| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0006099|"GO:tricarboxylic acid cycle"|Tricarboxylic acid cycle| PROS 27->56|PS00189|LIPOYL|PDOC00168| PROS 156->185|PS00189|LIPOYL|PDOC00168| NREPEAT 1 REPEAT 2|5->62|134->191| SEG 63->75|eddvvevggelgv| SEG 77->130|seageapaesapapeapaaeapaeesaaaepepepaqaeqapaqqpaasgdaae| SEG 209->275|kpaaasapapapapetkaepkpepapepkpepapepkpepkpepapapkaeqpapaaqaqpqapapa| SEG 317->343|aaaeakkapaaaaapaakapsapapap| SEG 388->397|aalraqakaa| SEG 472->483|araiadiadrar| BL:PDB:NREP 4 BL:PDB:REP 2->60|1labA|9e-10|40.7|59/80| BL:PDB:REP 135->202|1labA|6e-12|42.6|68/80| BL:PDB:REP 283->315|1w4hA|3e-06|48.5|33/45| BL:PDB:REP 356->578|1sczA|2e-38|39.4|216/233| RP:PDB:NREP 4 RP:PDB:REP 5->62|2dneA|9e-11|32.8|58/108| RP:PDB:REP 131->205|3bg5A|8e-14|30.7|75/1137| RP:PDB:REP 276->316|1balA|2e-11|39.0|41/51| RP:PDB:REP 352->578|1c4tA|2e-64|38.6|220/226| RP:PFM:NREP 4 RP:PFM:REP 4->62|PF00364|8e-09|40.7|59/74|Biotin_lipoyl| RP:PFM:REP 134->205|PF00364|2e-11|44.4|72/74|Biotin_lipoyl| RP:PFM:REP 284->316|PF02817|3e-07|66.7|33/39|E3_binding| RP:PFM:REP 356->578|PF00198|3e-48|47.5|217/232|2-oxoacid_dh| HM:PFM:NREP 5 HM:PFM:REP 351->579|PF00198|1.1e-77|46.8|222/231|2-oxoacid_dh| HM:PFM:REP 5->76|PF00364|6e-26|44.4|72/74|Biotin_lipoyl| HM:PFM:REP 133->205|PF00364|1.8e-24|45.2|73/74|Biotin_lipoyl| HM:PFM:REP 281->317|PF02817|6.6e-20|54.1|37/39|E3_binding| HM:PFM:REP 216->257|PF05887|3.9e-07|47.6|42/143|Trypan_PARP| GO:PFM:NREP 5 GO:PFM GO:0005515|"GO:protein binding"|PF02817|IPR004167| GO:PFM GO:0008152|"GO:metabolic process"|PF02817|IPR004167| GO:PFM GO:0008415|"GO:acyltransferase activity"|PF02817|IPR004167| GO:PFM GO:0008152|"GO:metabolic process"|PF00198|IPR001078| GO:PFM GO:0008415|"GO:acyltransferase activity"|PF00198|IPR001078| RP:SCP:NREP 4 RP:SCP:REP 1->62|1y8nB1|1e-13|33.9|62/97|b.84.1.1| RP:SCP:REP 131->202|1y8nB1|5e-15|31.9|72/97|b.84.1.1| RP:SCP:REP 276->316|1balA|3e-12|39.0|41/51|a.9.1.1| RP:SCP:REP 352->577|1c4tA|5e-69|38.8|219/226|c.43.1.1| HM:SCP:REP 1->98|1y8oB1|5e-28|52.0|98/0|b.84.1.1|1/2|Single hybrid motif| HM:SCP:REP 127->227|1y8oB1|2.9e-26|46.5|101/0|b.84.1.1|2/2|Single hybrid motif| HM:SCP:REP 272->322|1balA_|3.4e-13|54.9|51/51|a.9.1.1|1/1|Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex| HM:SCP:REP 336->578|1eafA_|2.6e-78|48.9|237/243|c.43.1.1|1/1|CoA-dependent acyltransferases| OP:NHOMO 2701 OP:NHOMOORG 991 OP:PATTERN 11------1111111---111---2111--11----------------------------1111---- 1223522222223242333-322242333333444435764444344433335574462244434274644-----------4---1-111--1--22233334333333333333333333332---1----11-35533---221111111111111111111111121111111111111333331--424444444443444444464454444455344322222242233333333333333344432-1-22-1---111111111111111222111112211111-111111111111111111211111111211---1111111-1--211---------3--------------11311-13-2422222222224223222222244444433443-223225232422233232543344223233142222232444444443332222222222222221122222222222222222235831232233443443333322253333243334444233332322222444222211112322222222223322-1-2----------323133421333333-21-----------------------1--3223323343434333343333333333441-2422222122232222222222233322-222223322223222222323322232222222222222222222222222222222222222222223333333333223232222222222222223333323222324444343333333222222222222211223222223323333232332222222111-222221----------111111-1-11111111211111-------------223 22--444-733-3333332343344433333333333423333333223444442333333332222222222222222222222222-23232222222223545-34474666554342244453739b4-64B2322523544444443252854449F36342434B54534534l434458AED3B55485563 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 419 STR:RPRED 71.4 SQ:SECSTR EEEETTcTTEEEccccEEEEEEcccTTcEEcTTcEEEEEEccccEEEEEccccEEccEEccc####################################################################cccTTcTTEEEccccEEEEEEcccTTcEEcTTcEEEEEEccccEEEEEccccEEccEEcccTTcEEcTTcEEEEcccc###################################################################cccccccccGGGTTHHHHTTccTTccccccTTccccHHHHT############################ccccccccccccccccHHHHHHHHHHHcccEEEEEEEEEcHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHcEEETTccEEEccccccEEEcEEETTEEEccEEccTTTccHHHHHHHHHHHHHHHHTTcccTTTTccccEEEEEcGGGTcccccccccTTccEEEEEcccEEEEEEEcccccTTEEEEEEEEEEEEEEETTTccHHHHHHHHHHHHHHHTcEEEc##### DISOP:02AL 82-137, 211-309, 318-352| PSIPRED ccEEEEcccccccccEEEEEEEEEccccEEccccEEEEEEcccEEEEEccccccEEEEEEcccccEEccccEEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccEEcccccccccccEEEEEEcccccccccccEEEEEcccccEEEEEcccccEEEEEEcccccEEccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccHHHHHHHcccHHHccccccccccccccHHHHHHHccccccccccccccccccccccccccccccEEccccHHHHHHHHHHHHHHcccEEEEEEEEcHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccEEEEEEEccccEEEEcccccEEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHHHHccccHHHHccccEEEEEccccccEEEEcEEccccEEEEEccccEEEEEEEccccccccEEEEEEEEEEEEEcccEEEHHHHHHHHHHHHHHHccccHHHHccc //