[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : thrB
DDBJ      :thrB         putative homoserine kinase
Swiss-Prot:KHSE_NOCFA   RecName: Full=Homoserine kinase;         Short=HSK;         Short=HK;         EC=2.7.1.39;

Homologs  Archaea  3/68 : Bacteria  220/915 : Eukaryota  100/199 : Viruses  0/175   --->[See Alignment]
d.14.1d.58.26
:315 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->281 3hulA PDBj 2e-12 32.0 %
:RPS:PDB   6->287 2aj4A PDBj 1e-18 12.2 %
:RPS:SCOP  9->158 1fwkA1  d.14.1.5 * 1e-15 24.1 %
:RPS:SCOP  187->314 1fwkA2  d.58.26.1 * 1e-20 23.4 %
:HMM:SCOP  9->171 1fwkA1 d.14.1.5 * 6.3e-31 35.7 %
:HMM:SCOP  185->315 1fwkA2 d.58.26.1 * 4.9e-26 35.9 %
:HMM:PFM   87->153 PF00288 * GHMP_kinases_N 4.2e-14 45.9 61/68  
:HMM:PFM   245->287 PF08544 * GHMP_kinases_C 9.1e-07 32.6 43/82  
:BLT:SWISS 1->315 KHSE_NOCFA e-157 100.0 %
:PROS 94->105|PS00627|GHMP_KINASES_ATP
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55896.1 GT:GENE thrB GT:PRODUCT putative homoserine kinase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1160321..1161268 GB:FROM 1160321 GB:TO 1161268 GB:DIRECTION + GB:GENE thrB GB:PRODUCT putative homoserine kinase GB:PROTEIN_ID BAD55896.1 LENGTH 315 SQ:AASEQ MTRTLPAGLTVTARVPASSANLGPGFDSLGMALGIYDEIEVRTTDSGLTIRVEGEGADDVPWGPSHLVVRAIERGLEHAGVWADGLDVVCRNVIPHSRGLGSSASAVVGGLAAGCALAAKLDESLATAADELVQLASEFEGHPDNAAASVLGGIVVSWTETSAEAQAEVPDHGRVYRAVRLDPHPTLRPVVLIPEVRSSTAHTRGLLPESVPHGDAAFNVSRAALAVVALTTRPDLLMPATADRLHQAQRAPALPLTTRWIDRLRAAGIPATVSGAGPTVLALGTGEFPAELRALAAEEGLRVVEPGLAEGVLVD GT:EXON 1|1-315:0| SW:ID KHSE_NOCFA SW:DE RecName: Full=Homoserine kinase; Short=HSK; Short=HK; EC=2.7.1.39; SW:GN Name=thrB; OrderedLocusNames=NFA_10510; SW:KW Amino-acid biosynthesis; ATP-binding; Complete proteome; Cytoplasm;Kinase; Nucleotide-binding; Threonine biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->315|KHSE_NOCFA|e-157|100.0|315/315| GO:SWS:NREP 7 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009088|"GO:threonine biosynthetic process"|Threonine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 94->105|PS00627|GHMP_KINASES_ATP|PDOC00545| SEG 99->119|glgssasavvgglaagcalaa| SEG 290->302|aelralaaeeglr| BL:PDB:NREP 1 BL:PDB:REP 14->281|3hulA|2e-12|32.0|228/277| RP:PDB:NREP 1 RP:PDB:REP 6->287|2aj4A|1e-18|12.2|270/509| HM:PFM:NREP 2 HM:PFM:REP 87->153|PF00288|4.2e-14|45.9|61/68|GHMP_kinases_N| HM:PFM:REP 245->287|PF08544|9.1e-07|32.6|43/82|GHMP_kinases_C| RP:SCP:NREP 2 RP:SCP:REP 9->158|1fwkA1|1e-15|24.1|141/163|d.14.1.5| RP:SCP:REP 187->314|1fwkA2|1e-20|23.4|128/133|d.58.26.1| HM:SCP:REP 9->171|1fwkA1|6.3e-31|35.7|157/163|d.14.1.5|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 185->315|1fwkA2|4.9e-26|35.9|131/133|d.58.26.1|1/1|GHMP Kinase, C-terminal domain| OP:NHOMO 327 OP:NHOMOORG 323 OP:PATTERN ------------------------1-------------------------------1----------1 -11-111111111111111-1111111111111111111111111111111111111111111111111111111111---111-111----------------------------------------------------------111-111-111111111111111111111111111111---1---11-1111111111111111---1111111111--11111111---------------1--11----11-----11--11-1-----11--------------------------------------------111111111111111-1111----1---1--1111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1-------11111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------1---------- ------1-211-11111111111111111-11111--1-11111111---1111-1111111111111111111-11-111--11111-11111111111111111-12---------------------------------------------------------------------11111------1--1111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 284 STR:RPRED 90.2 SQ:SECSTR ###cccccccEEEEEEEEEEEEccccGcEEEEEEEEEEEEEEEEcccccTTcccccccTTcccHHHHHHHHHHHHHHHHHHHccEEEEEEEEcccTTccccHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHHHTTGGccHHHHHHHHccTTcEEEEEcccccEEEEEccTTTccEEccccccEEEEEEEEcccccHcccTTTTTTTTHHHHHHHHHHHHHHHHHHTccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHGGGTTcccHH############################ DISOP:02AL 3-7| PSIPRED ccEEEccccEEEEEEEEEEccccccccEEEEEEccccEEEEEEccccEEEEEEEcccccccccccHHHHHHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccHHHHHHHccEEEEEEcccccEEEEccccccEEEEEEcccccccEEEEEEccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHcccEEEEEccccEEEEEEccccHHHHHHHHHHcccEEEEEEccccEEEc //