[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : ureA
DDBJ      :ureA         putative urease gamma subunit
Swiss-Prot:URE3_NOCFA   RecName: Full=Urease subunit gamma;         EC=3.5.1.5;AltName: Full=Urea amidohydrolase subunit gamma;

Homologs  Archaea  6/68 : Bacteria  319/915 : Eukaryota  84/199 : Viruses  0/175   --->[See Alignment]
d.8.1
:100 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->99 1ejwA PDBj 5e-35 68.7 %
:RPS:PDB   1->99 1ejwA PDBj 2e-47 68.7 %
:RPS:SCOP  1->99 1a5kA  d.8.1.1 * 2e-47 68.7 %
:HMM:SCOP  1->100 4ubpA_ d.8.1.1 * 4.2e-45 70.0 %
:RPS:PFM   1->99 PF00547 * Urease_gamma 2e-33 76.8 %
:HMM:PFM   1->99 PF00547 * Urease_gamma 6e-52 71.7 99/99  
:BLT:SWISS 1->100 URE3_NOCFA 3e-53 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57371.1 GT:GENE ureA GT:PRODUCT putative urease gamma subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2688419..2688721 GB:FROM 2688419 GB:TO 2688721 GB:DIRECTION + GB:GENE ureA GB:PRODUCT putative urease gamma subunit GB:PROTEIN_ID BAD57371.1 LENGTH 100 SQ:AASEQ MRLSPHEQERLLLSYAAELARRRQARGLKLNHPEAVALITDHVLEGARDGRSVAELMASGRTVLTRDDVMTGVPEMIHDVQVEATFPDGTKLVTVHQPIA GT:EXON 1|1-100:0| SW:ID URE3_NOCFA SW:DE RecName: Full=Urease subunit gamma; EC=3.5.1.5;AltName: Full=Urea amidohydrolase subunit gamma; SW:GN Name=ureA; OrderedLocusNames=NFA_25240; SW:KW Complete proteome; Cytoplasm; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->100|URE3_NOCFA|3e-53|100.0|100/100| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 1->99|1ejwA|5e-35|68.7|99/100| RP:PDB:NREP 1 RP:PDB:REP 1->99|1ejwA|2e-47|68.7|99/100| RP:PFM:NREP 1 RP:PFM:REP 1->99|PF00547|2e-33|76.8|99/99|Urease_gamma| HM:PFM:NREP 1 HM:PFM:REP 1->99|PF00547|6e-52|71.7|99/99|Urease_gamma| GO:PFM:NREP 3 GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00547|IPR002026| GO:PFM GO:0009039|"GO:urease activity"|PF00547|IPR002026| GO:PFM GO:0016151|"GO:nickel ion binding"|PF00547|IPR002026| RP:SCP:NREP 1 RP:SCP:REP 1->99|1a5kA|2e-47|68.7|99/100|d.8.1.1| HM:SCP:REP 1->100|4ubpA_|4.2e-45|70.0|100/100|d.8.1.1|1/1|Urease, gamma-subunit| OP:NHOMO 468 OP:NHOMOORG 409 OP:PATTERN ------1--------1--------1---1--1----------------------------------1- ----1--1111-111--11-12--1211111111111211-1111-1-----11111-------1-3223-----1----------------1--------1---11-------------------------------------111-11--1-1--1111-1111-111111-11111-1-1--1-------1------1---------1---1----1-1----------1-11111111111111111-1---------------------------------------------------------------111---------------------------1-11-------------------1---------------11133---1111122222222222-3413313211--111111111111111--111111111111111111----1---------------------------------------111-1111111111111211111111111111-1111111--111111-11-1-1-1---------1-11--------------------------11-1--1----------211111111---------1111---11-------1--------------11-1------1---11--12--------1---------1--------111--111--------------------------1111111-111111------------1111111----1111----1111111-2-1-11111111111111212-----------11---------------------------1----------------------------------------111-----------1- -------------11111-1-2111111111-1111111111111111111-11-1111111------------------------11-121112111111-1221--2-1----------------------------------------------------11--------2-----8111--1-121111111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 100.0 SQ:SECSTR ccccHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHTccHHHHHHHGGGcccGGGccTTHHHHccEEEEEEEETTEEEEEEEEcccc PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHccccHHHHHHHHcEEEEcccccEEEEEEcccc //