[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : ureB
DDBJ      :ureB         putative urease beta subunit
Swiss-Prot:URE2_NOCFA   RecName: Full=Urease subunit beta;         EC=3.5.1.5;AltName: Full=Urea amidohydrolase subunit beta;

Homologs  Archaea  6/68 : Bacteria  314/915 : Eukaryota  89/199 : Viruses  0/175   --->[See Alignment]
b.85.3
:108 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->105 1ie7B PDBj 1e-25 49.5 %
:RPS:PDB   1->92 1ejwB PDBj 1e-32 51.1 %
:RPS:SCOP  1->92 1a5kB  b.85.3.1 * 8e-33 51.1 %
:HMM:SCOP  1->103 4ubpB_ b.85.3.1 * 7.8e-41 62.1 %
:RPS:PFM   2->92 PF00699 * Urease_beta 4e-22 59.3 %
:HMM:PFM   2->99 PF00699 * Urease_beta 8.8e-45 63.3 98/100  
:BLT:SWISS 1->108 URE2_NOCFA 2e-53 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57372.1 GT:GENE ureB GT:PRODUCT putative urease beta subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2688729..2689055 GB:FROM 2688729 GB:TO 2689055 GB:DIRECTION + GB:GENE ureB GB:PRODUCT putative urease beta subunit GB:PROTEIN_ID BAD57372.1 LENGTH 108 SQ:AASEQ MIPGEYLCADGVIEINPGRERIALDVVNTGDRPVQVGSHVHFPQANAALDFDRAAAHGCRLDIPAGTAVRFEPGLAQRVSLVPLAGTREVYGIGPNPPGKLDDPEGEQ GT:EXON 1|1-108:0| SW:ID URE2_NOCFA SW:DE RecName: Full=Urease subunit beta; EC=3.5.1.5;AltName: Full=Urea amidohydrolase subunit beta; SW:GN Name=ureB; OrderedLocusNames=NFA_25250; SW:KW Complete proteome; Cytoplasm; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->108|URE2_NOCFA|2e-53|100.0|108/108| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| SEG 45->56|anaaldfdraaa| BL:PDB:NREP 1 BL:PDB:REP 1->105|1ie7B|1e-25|49.5|105/122| RP:PDB:NREP 1 RP:PDB:REP 1->92|1ejwB|1e-32|51.1|92/101| RP:PFM:NREP 1 RP:PFM:REP 2->92|PF00699|4e-22|59.3|91/100|Urease_beta| HM:PFM:NREP 1 HM:PFM:REP 2->99|PF00699|8.8e-45|63.3|98/100|Urease_beta| GO:PFM:NREP 3 GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00699|IPR002019| GO:PFM GO:0009039|"GO:urease activity"|PF00699|IPR002019| GO:PFM GO:0016151|"GO:nickel ion binding"|PF00699|IPR002019| RP:SCP:NREP 1 RP:SCP:REP 1->92|1a5kB|8e-33|51.1|92/101|b.85.3.1| HM:SCP:REP 1->103|4ubpB_|7.8e-41|62.1|103/0|b.85.3.1|1/1|Urease, beta-subunit| OP:NHOMO 467 OP:NHOMOORG 409 OP:PATTERN ------1--------1--------1---1--1----------------------------------1- ----1--1111-111--11-12--1211111111111211-111--1-----11111-------1-3123-----1----------------1--------1---11-------------------------------------1-1-11--1----1111-1111-111111-11111-1-1--1-------1------1---------1---1----1-1----------1-11111111111111111-1---------------------------------------------------------------111---------------------------1-11-----------------------------------11133---1111122222222222-3413213211--12-111111111111--111111111111111111----1---------------------------------------111-1111111111111211111111111111-1111111--111111-11-1-1-1---------1-11--------------------------11-1--1----------111111111---------1111---11-------1--------------11-1------1---11--12--------1---------1--------111--111--------------------------11111111111111------------1111111----111-----1111111-1-1-11111111111111212-----------11---------------------------1----------------------------------------111-----------1- -------------11111111211111111111111111111111111112112-1111111------------------------11-12111211111121221--2-2----------------------------------------------------11--------1-----8111--1-111111111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 97.2 SQ:SECSTR ccTTccccccccccccTTccEEEEEEEEcccccEEEETTccGGGccTTEEccTTTTTTEEEcccTTcEEEEcTTcEEEEEEEEccTTcEEccTTccccEEccHHH### DISOP:02AL 100-108| PSIPRED cccccEEEccccEEEcccccEEEEEEEEcccccEEEccEEEHHHccccccccHHHcccEEEEcccccEEEEccccEEEEEEEEEcccEEEEEcccccccccccccccc //