[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : ureD
DDBJ      :ureD         putative urease accessory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:264 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   60->199 PF01774 * UreD 1.9e-15 25.5 137/210  
:BLT:SWISS 61->251 URED1_SACEN 2e-16 34.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57388.1 GT:GENE ureD GT:PRODUCT putative urease accessory protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2703707..2704501 GB:FROM 2703707 GB:TO 2704501 GB:DIRECTION + GB:GENE ureD GB:PRODUCT putative urease accessory protein GB:PROTEIN_ID BAD57388.1 LENGTH 264 SQ:AASEQ MPRLSGGASAPAGAGACDGLSSDSGSPVHTRLRIVAEAGTLPRIEACGGLAARRTGPETVHLVGTAATPLGGDHLDITVVVGPGARLAVRAVAAALALPGRGTPVSTAHWRFEVAAYGELDIDTPAMIVAGGAEHRTATTALLDPDARLRMRELVQIGRSGERHGRWRGDLTADLGDLPLVRHRIELGERTAVDDVLTAPRALVSELRYPDDRPVATHGVAAARLPLAPGGSLFTGLGDRLADTPTPERLTDAAAVHAQSSPRR GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 61->251|URED1_SACEN|2e-16|34.0|191/255| SEG 6->19|ggasapagagacdg| SEG 79->102|vvvgpgarlavravaaalalpgrg| HM:PFM:NREP 1 HM:PFM:REP 60->199|PF01774|1.9e-15|25.5|137/210|UreD| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --------------1--11-11--1111111111111-11--------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 259-264| PSIPRED ccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEcccEEEccccccEEEEEEcccHHccccEEEEEEEEccccEEEEEcHHHEEEEcccccccEEEEEEEEEccccEEEEcccccccccccEEEEEEEEEEccccEEEEEEEEccccccccccEEEEEEEEEEccEEEEEEEEEccccccccccEEccHHHHHHHHHcccccHHHcccHHHHcccccccccccHHHHHccccccHHHHHHHHHEEccccccc //