[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : ureF
DDBJ      :ureF         putative urease accessory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:216 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   46->178 PF01730 * UreF 8.8e-13 23.5 132/146  
:BLT:SWISS 10->216 UREF_MYCBT 1e-36 38.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57386.1 GT:GENE ureF GT:PRODUCT putative urease accessory protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2702254..2702904 GB:FROM 2702254 GB:TO 2702904 GB:DIRECTION + GB:GENE ureF GB:PRODUCT putative urease accessory protein GB:PROTEIN_ID BAD57386.1 LENGTH 216 SQ:AASEQ MNSSGAQPRAILYALADSRLPIGGHVHSGGVEEAVTSGLVRDLTSVEAYLRRRVATSGLVAASLAAAVCAGELTLGRADAEADARTLAPAARAASRAQGRGLLRLAKQVWPQAQWRSLPSKPHLSTAFGAVGLACGAAPAEIAGVVVYSTLTGAATAAQRLLALDPADIAACTVRLAPVCDRTAAAAVTGLAALSDPLQDVLAERHPRRDMPLFAS GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 10->216|UREF_MYCBT|1e-36|38.6|207/211| SEG 55->71|atsglvaaslaaavcag| SEG 77->106|radaeadartlapaaraasraqgrgllrla| SEG 183->194|taaaavtglaal| HM:PFM:NREP 1 HM:PFM:REP 46->178|PF01730|8.8e-13|23.5|132/146|UreF| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- --------------1--11-11--1111111111111-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHcHHHHHHHHHccccHHHHcccc //