[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : ureG
DDBJ      :ureG         putative urease accessory protein
Swiss-Prot:UREG_NOCFA   RecName: Full=Urease accessory protein ureG;

Homologs  Archaea  10/68 : Bacteria  320/915 : Eukaryota  87/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:238 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->224 2hf9B PDBj 5e-12 33.1 %
:RPS:PDB   26->51 1akyA PDBj 1e-04 30.8 %
:RPS:PDB   26->98 3dm9B PDBj 2e-04 23.3 %
:RPS:SCOP  25->191 2p67A1  c.37.1.10 * 6e-16 28.2 %
:HMM:SCOP  27->194 1xjcA_ c.37.1.10 * 3.7e-23 33.8 %
:RPS:PFM   34->177 PF02492 * cobW 5e-11 37.8 %
:HMM:PFM   30->197 PF02492 * cobW 2.7e-37 31.6 158/173  
:BLT:SWISS 1->238 UREG_NOCFA e-125 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57387.1 GT:GENE ureG GT:PRODUCT putative urease accessory protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2702932..2703648 GB:FROM 2702932 GB:TO 2703648 GB:DIRECTION + GB:GENE ureG GB:PRODUCT putative urease accessory protein GB:PROTEIN_ID BAD57387.1 LENGTH 238 SQ:AASEQ MPPHLIDGEPHDHAHDRPKRQRTPGEPLRIGIGGPVGSGKTALVAALCKQLREELSLAVLTNDIYTTEDADFLRRHAVLPDERITAVQTGGCPHTAIRDDITANLDAIDDLIAANPPLDLILVESGGDNLTATFSSGLIDVQIFVIDVAGGDKVPRKGGPGVTYSDLLVVNKTDLAPLVGADLGVMERDAAKVRQGRPTALISLTDDPAATPVLAWVREQLAAIAEADRHGAASGIAH GT:EXON 1|1-238:0| SW:ID UREG_NOCFA SW:DE RecName: Full=Urease accessory protein ureG; SW:GN Name=ureG; OrderedLocusNames=NFA_25400; SW:KW Chaperone; Complete proteome; Cytoplasm; GTP-binding;Nickel insertion; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->238|UREG_NOCFA|e-125|100.0|238/238| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| SEG 99->115|dditanldaiddliaan| BL:PDB:NREP 1 BL:PDB:REP 34->224|2hf9B|5e-12|33.1|181/209| RP:PDB:NREP 2 RP:PDB:REP 26->51|1akyA|1e-04|30.8|26/218| RP:PDB:REP 26->98|3dm9B|2e-04|23.3|73/301| RP:PFM:NREP 1 RP:PFM:REP 34->177|PF02492|5e-11|37.8|135/174|cobW| HM:PFM:NREP 1 HM:PFM:REP 30->197|PF02492|2.7e-37|31.6|158/173|cobW| RP:SCP:NREP 1 RP:SCP:REP 25->191|2p67A1|6e-16|28.2|142/301|c.37.1.10| HM:SCP:REP 27->194|1xjcA_|3.7e-23|33.8|154/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 474 OP:NHOMOORG 417 OP:PATTERN ---1-11--------1--------1---1--1-----1----1-----------------------1- 1-1-1--1111-111--11-12--1211111111111211-111--1-----11111-------1-2113-----1----1--------------------1---11-------------------------------------1-2-11--111--1111-1111-111111-11111-1-1--1--------------1---------1--------1-1----------1-11111111111111111-1---------------------------------------------------------------111---------------------------1-11------11---------------------------11133---1111122222222211-3413313211--111111111111111--111111111111111111----1---------------------------------------111-1111111111111211111111111111-1111111--111111-11-1-1-1---------1-11--------------------------11-1--1----------111111111---------1111---11-------1--------------11-2------1---11--12--------1---------1--------111--111--------------------------11111111111111------------1111111----1111----1111111-2-1-11111111111111212-----------11---------------------------1----------------------------------------111-----------1- -------------1111111121111111111111111-111111111111111-11111--------------------------11-12111111111111111----2----------------------------------------------------21-----3--2-----8111--11321111111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 193 STR:RPRED 81.1 SQ:SECSTR #########################cccEEEEEccTTccHHHHHHHHHHHHHTTccEEEEEccTTcHHHHHHHHHHHHHHTcEEEcccTTccHHHHHHHHHHHHHTccTTcccEEEEEcc#####ccccTTTTccccc#cEEEEEEEGGGcTTTTTTcHHHHHTccEEEEEcGGGHHHHTccHHHHHHHHHHHcTTcEEEEccTTTcTTHHHHHHHHHHHHHTc############## DISOP:02AL 14-17, 19-21, 223-238| PSIPRED ccccccccccHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHcccccccEEEEEcccccccccccccHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHcccEEEEEcHHHHHHccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHcHHHHHHccccccc //