[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : yrbE1B
DDBJ      :yrbE1B       putative YrbE family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  455/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
:283 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   70->238 PF02405 * DUF140 2e-26 43.2 %
:HMM:PFM   63->271 PF02405 * DUF140 9.6e-63 37.5 200/215  
:BLT:SWISS 24->207 Y080_RICFE 7e-16 30.3 %
:PROS 248->262|PS00211|ABC_TRANSPORTER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55381.1 GT:GENE yrbE1B GT:PRODUCT putative YrbE family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 552034..552885 GB:FROM 552034 GB:TO 552885 GB:DIRECTION + GB:GENE yrbE1B GB:PRODUCT putative YrbE family protein GB:PROTEIN_ID BAD55381.1 LENGTH 283 SQ:AASEQ MAFVIQSRFPRAVRRVRRMSDSLDSVGKHAVFYAQALASIPRALMHYRTETIRLIAEISMGTGALAVIGGTVVIVGFLTLFSGGTIAVQGYSSLGNIGVEALTGFFSAFLNVRIAAPVISGIGLAATIGAGSTAQLGAMRVSEEIDALETMAIRPVPYLIGTRVLAGMIAIVPLYALAVIASFFAARFATVVIYGQSAGVYDHYFSTFLIPSDILWSFSQAILMALAVMMIHTYYGYFAAGGPVGVGVAVGNAVRASLVAVVTVTLLMSLAIYGTSGNFNLSG GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 24->207|Y080_RICFE|7e-16|30.3|175/259| PROS 248->262|PS00211|ABC_TRANSPORTER_1|PDOC00185| TM:NTM 5 TM:REGION 57->79| TM:REGION 102->124| TM:REGION 168->190| TM:REGION 210->231| TM:REGION 246->268| SEG 8->18|rfpravrrvrr| SEG 239->271|aaggpvgvgvavgnavraslvavvtvtllmsla| RP:PFM:NREP 1 RP:PFM:REP 70->238|PF02405|2e-26|43.2|169/215|DUF140| HM:PFM:NREP 1 HM:PFM:REP 63->271|PF02405|9.6e-63|37.5|200/215|DUF140| OP:NHOMO 649 OP:NHOMOORG 469 OP:PATTERN -------------------------------------------------------------------- 111-----------68633-371176434445D7867859----------------------2-143222-------------11111-----11-1--11211122222-------111----111111111121----------1-1---1111111111-11111111-111---1-11--------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111--------1-1-11-1--211-------------------1--21---111-111----22-11111111-1--------11111212-----111--1111111111111111111-111------1111111111111111111111111111111111--111--1----11211111-------111-1-222-1121132111112113232112111223-11-1------11--------21112211212-111111111113111111111111---1211------111111-1111111111-1111111111111111111111111111111111111111111111111111-111111111111--1------11111-1111111111111111111111111---1-1111111122222211111111111111111111111111111--------1111---1221111----------------------------------------------121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1116111111--1-31------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 283-284| PSIPRED cHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //