[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : yrbE2B
DDBJ      :yrbE2B       putative YrbE family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  323/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
:288 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   94->277 PF02405 * DUF140 1e-24 37.5 %
:HMM:PFM   72->276 PF02405 * DUF140 1.1e-59 37.1 205/215  
:BLT:SWISS 103->278 Y1045_SYNY3 2e-15 27.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55959.1 GT:GENE yrbE2B GT:PRODUCT putative YrbE family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1240840..1241706 GB:FROM 1240840 GB:TO 1241706 GB:DIRECTION + GB:GENE yrbE2B GB:PRODUCT putative YrbE family protein GB:PROTEIN_ID BAD55959.1 LENGTH 288 SQ:AASEQ MAVSSYVPKGLGPLVRYVRRGGLVLRGIESFGFVAVFVWQVLSAVPLTLSRYRAETMRAITNMTWGRGSIVVGGGTVPMMVVLGLVMGASVGVESFATLDMLGMGPVTGIVSAYATTRELAPIAAAVGFAAQAGCRITAEIGSMRISEEIDAIESLGLRSVPFVVTTRVIAGALAIVPTFLIALILAYAACRGLITLLHGQSAGVYDHYFFQFVSGFDVIAAVIKVAVFGTVVILVHSYYGFFAKGGPEGVGIASGRAVRTSFVAIIAIDMVLSIVLWGFNSAISFTG GT:EXON 1|1-288:0| BL:SWS:NREP 1 BL:SWS:REP 103->278|Y1045_SYNY3|2e-15|27.8|176/263| TM:NTM 6 TM:REGION 26->48| TM:REGION 66->88| TM:REGION 117->138| TM:REGION 163->185| TM:REGION 216->238| TM:REGION 256->278| SEG 10->27|glgplvryvrrgglvlrg| SEG 71->93|vvgggtvpmmvvlglvmgasvgv| SEG 121->133|apiaaavgfaaqa| RP:PFM:NREP 1 RP:PFM:REP 94->277|PF02405|1e-24|37.5|184/215|DUF140| HM:PFM:NREP 1 HM:PFM:REP 72->276|PF02405|1.1e-59|37.1|205/215|DUF140| OP:NHOMO 557 OP:NHOMOORG 336 OP:PATTERN -------------------------------------------------------------------- 11------------8BA66-6A1198767777G8A8795D----------------------4-122222-------------11111-----11-1---1211122212-------111----111-11111-21-----------12111211111111111211112111111111-111-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2211--------1------11-11-----------------------2---------------11----1-11--1--------11111111-----1111111-------------1111-1----1---1111111111111111111111111111112111--1111--1--111-111---------11111-212--122123112-12112232211111223-----11111--1--------211-11----1------11111-2-1111111-111---11-1-----------1----------------------------------11-------------------1-----------------------1------11111-111---------------1111111---1-111111111111111111111111111111-----------11111111111111---1111111----------------------------------------------121 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1117-1-111121-31------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //