[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : yrbE3B
DDBJ      :yrbE3B       putative YrbE family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  428/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
:295 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   106->282 PF02405 * DUF140 2e-21 39.0 %
:HMM:PFM   79->284 PF02405 * DUF140 1.9e-62 38.3 206/215  
:BLT:SWISS 116->286 YRBE_SHIFL 9e-17 31.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57824.1 GT:GENE yrbE3B GT:PRODUCT putative YrbE family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3161459..3162346) GB:FROM 3161459 GB:TO 3162346 GB:DIRECTION - GB:GENE yrbE3B GB:PRODUCT putative YrbE family protein GB:PROTEIN_ID BAD57824.1 LENGTH 295 SQ:AASEQ MSAAPGGQWTTRPSPYRPPGLRWTLRTQRAWDPLEELGFQLRFGIAAVAGVGWALRRYRAQVVAVFTDLAWGNGRAVIVGGGVAPVLVVMGVVAGAMIGLVGITALDTLGMGPLAGAMSALANPRELAPLIAAVGFAAQAGCRMTAEIGAMRIAEEIDALEAQAIDPIPYVVSTRLLAAVLTVVPTYLIALALGFLTTKLTVTAVHGEAAGSFEHYFQMFVEPRDLVYSLVKVVIFVVIVTGVHAYQGFYATGGPEGVGVASGRAIRASLVLIATADMVLTVAMWGFDTEIGFGG GT:EXON 1|1-295:0| BL:SWS:NREP 1 BL:SWS:REP 116->286|YRBE_SHIFL|9e-17|31.6|171/260| TM:NTM 6 TM:REGION 34->55| TM:REGION 79->101| TM:REGION 123->144| TM:REGION 173->195| TM:REGION 225->247| TM:REGION 262->284| SEG 72->102|gngravivgggvapvlvvmgvvagamiglvg| SEG 227->243|vyslvkvvifvvivtgv| RP:PFM:NREP 1 RP:PFM:REP 106->282|PF02405|2e-21|39.0|177/215|DUF140| HM:PFM:NREP 1 HM:PFM:REP 79->284|PF02405|1.9e-62|38.3|206/215|DUF140| OP:NHOMO 622 OP:NHOMOORG 438 OP:PATTERN -------------------------------------------------------------------- 11------------6A955-571187656666D686685A----------------------3-132222-------------11111-----11-1----1---21212--------------111111111121----------1122112111111111122111121-111---1-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111-------------------------------------------2---------------1-----1111--1--------1--1-111-----111--111----11-11---111--1--------11111111111111111111111111111111111111111111111111111--------111111212-1121122112111112132212111322-1------------------1211-1111111-111121111111111111111111---12-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1------11111-1111111111111111111111111---1-1111111111111111111111111111111111111111111111111111111---1111111----------------------------------------------121 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1117---111--1-31------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //