[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56558.1
DDBJ      :             DNA polymerase III, beta subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  893/915 : Eukaryota  2/199 : Viruses  2/175   --->[See Alignment]
d.131.1
:367 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->367 1mmiA PDBj 3e-89 46.7 %
:RPS:PDB   1->366 2awaB PDBj 1e-84 26.4 %
:RPS:SCOP  1->119 1jqjA1  d.131.1.1 * 6e-32 47.9 %
:RPS:SCOP  126->245 1vpkA2  d.131.1.1 * 4e-30 23.1 %
:RPS:SCOP  246->367 1vpkA3  d.131.1.1 * 1e-30 31.1 %
:HMM:SCOP  1->116 1vpkA2 d.131.1.1 * 5e-26 37.1 %
:HMM:SCOP  125->245 1vpkA2 d.131.1.1 * 7.8e-26 36.4 %
:HMM:SCOP  246->367 2polA3 d.131.1.1 * 5.3e-36 45.9 %
:RPS:PFM   1->118 PF00712 * DNA_pol3_beta 2e-24 49.6 %
:RPS:PFM   129->244 PF02767 * DNA_pol3_beta_2 2e-15 37.4 %
:RPS:PFM   246->366 PF02768 * DNA_pol3_beta_3 3e-25 43.8 %
:HMM:PFM   1->118 PF00712 * DNA_pol3_beta 1.2e-39 46.6 118/120  
:HMM:PFM   129->244 PF02767 * DNA_pol3_beta_2 1.6e-36 40.0 115/116  
:HMM:PFM   246->366 PF02768 * DNA_pol3_beta_3 2.3e-35 40.5 121/121  
:BLT:SWISS 1->367 DPO3B_VIBCH 9e-90 44.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56558.1 GT:GENE ABA56558.1 GT:PRODUCT DNA polymerase III, beta subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2396..3499 GB:FROM 2396 GB:TO 3499 GB:DIRECTION + GB:PRODUCT DNA polymerase III, beta subunit GB:PROTEIN_ID ABA56558.1 GB:DB_XREF GI:76881877 InterPro:IPR001001 LENGTH 367 SQ:AASEQ MRFSIKREEIVRHLVTVCGVVERRHTLPILSNVLLSVKDSQLSLMATDLEIEIRTALKVLSSEEGKVTVSARKFLEICRALPSGSALEAQYKEGQFYIHSGRSRFTLSTLPAEDFPSIDSIDAVAELELTQAELKQLLHRTVFCMAHQDVRYYLNGLLLELTEESIHAVATDGHRLALASLAKGADQEGTEIQSIIPRKAILELVRLLEESQEPVRLKFGTNQMRAEFQGLSFSTKLIDGQFPDYKRVIPVGCEKQFVADRERFKQALVRVNILTNDKYRGVHLHLSDLKLQAIVTNLEQGSAEEELDIKYQGENLEIVFNNFYLIDVLNIIDTKEVRLTFTNASSSCLITPIDASDSKYVVMPMRL GT:EXON 1|1-367:0| BL:SWS:NREP 1 BL:SWS:REP 1->367|DPO3B_VIBCH|9e-90|44.9|365/366| BL:PDB:NREP 1 BL:PDB:REP 1->367|1mmiA|3e-89|46.7|364/366| RP:PDB:NREP 1 RP:PDB:REP 1->366|2awaB|1e-84|26.4|364/375| RP:PFM:NREP 3 RP:PFM:REP 1->118|PF00712|2e-24|49.6|117/119|DNA_pol3_beta| RP:PFM:REP 129->244|PF02767|2e-15|37.4|115/116|DNA_pol3_beta_2| RP:PFM:REP 246->366|PF02768|3e-25|43.8|121/121|DNA_pol3_beta_3| HM:PFM:NREP 3 HM:PFM:REP 1->118|PF00712|1.2e-39|46.6|118/120|DNA_pol3_beta| HM:PFM:REP 129->244|PF02767|1.6e-36|40.0|115/116|DNA_pol3_beta_2| HM:PFM:REP 246->366|PF02768|2.3e-35|40.5|121/121|DNA_pol3_beta_3| GO:PFM:NREP 15 GO:PFM GO:0003677|"GO:DNA binding"|PF00712|IPR001001| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF00712|IPR001001| GO:PFM GO:0006260|"GO:DNA replication"|PF00712|IPR001001| GO:PFM GO:0008408|"GO:3'-5' exonuclease activity"|PF00712|IPR001001| GO:PFM GO:0009360|"GO:DNA polymerase III complex"|PF00712|IPR001001| GO:PFM GO:0003677|"GO:DNA binding"|PF02767|IPR001001| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF02767|IPR001001| GO:PFM GO:0006260|"GO:DNA replication"|PF02767|IPR001001| GO:PFM GO:0008408|"GO:3'-5' exonuclease activity"|PF02767|IPR001001| GO:PFM GO:0009360|"GO:DNA polymerase III complex"|PF02767|IPR001001| GO:PFM GO:0003677|"GO:DNA binding"|PF02768|IPR001001| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF02768|IPR001001| GO:PFM GO:0006260|"GO:DNA replication"|PF02768|IPR001001| GO:PFM GO:0008408|"GO:3'-5' exonuclease activity"|PF02768|IPR001001| GO:PFM GO:0009360|"GO:DNA polymerase III complex"|PF02768|IPR001001| RP:SCP:NREP 3 RP:SCP:REP 1->119|1jqjA1|6e-32|47.9|119/122|d.131.1.1| RP:SCP:REP 126->245|1vpkA2|4e-30|23.1|117/123|d.131.1.1| RP:SCP:REP 246->367|1vpkA3|1e-30|31.1|122/123|d.131.1.1| HM:SCP:REP 1->116|1vpkA2|5e-26|37.1|116/0|d.131.1.1|1/3|DNA clamp| HM:SCP:REP 125->245|1vpkA2|7.8e-26|36.4|118/0|d.131.1.1|2/3|DNA clamp| HM:SCP:REP 246->367|2polA3|5.3e-36|45.9|122/0|d.131.1.1|1/1|DNA clamp| OP:NHOMO 948 OP:NHOMOORG 897 OP:PATTERN -------------------------------------------------------------------- 1111111111111111112-11111111111111112111111111111111111111111111111211211111111111111111111111111111111111121111111111111111111111111111111111211112211111111111111111122111111111111111211111141122222232123323311111122211121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112212111111111111111111111111111111111121111111111111111111111111111111111111-11111111111111121111111111111113111111111111111111111111111211111111111111111111111111211111111111111111111111111111111111111111111111112111111111111211111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111-1-1-1--11---1---11-------1111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---- ----------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------ STR:NPRED 367 STR:RPRED 100.0 SQ:SECSTR cEEEEEHHHHHHHHHHHHTTcccccccGGGGEEEEEEcccEEEEEEEcccEEEEEEEETTcGGGTEEEEEHHHHHHHHHHccccEEEEEEETTTEEEEEETTEEEEEEcccGGGccccccccccccEEEEHHHHHHHHHHHGGGccccTTcGGGGEEEEEEETTTEEEEEEcccEEEEEEEEEEcccccccEEEEEEHHHHHHHHHHccTTccEEEEEEcccEEEEEcccEEEEEEcccccccccGGGccccccEEEEEEHHHHHHHHHHHHHHTTcccccEEEEEETTEEEEEEEETTTEEEEEEEccEEEEccEEEEEcHHHHHHHHHTccccEEEEEEccccccEEEEEcccccEEEEEccccc DISOP:02AL 367-368| PSIPRED cEEEEEHHHHHHHHHHHHHHcccccccccccEEEEEEEccEEEEEEEccEEEEEEEEEEEEcccEEEEEEHHHHHHHHHHcccccEEEEEEEccEEEEEEccEEEEEccccHHHHccccccccccEEEEEHHHHHHHHHHHHHHHccccccEEEEEEEEEEEccEEEEEEEcccEEEEEEEEcccccccccEEEEEEHHHHHHHHHHHcccccEEEEEEEccEEEEEEccEEEEEEcccccccccHHcccccccEEEEEEHHHHHHHHHHHHHHHcccccEEEEEEEccEEEEEEEcccccEEEEEEEEEEccccEEEEEcHHHHHHHHHHccccEEEEEEEcccccEEEEEccccccEEEEEEEEc //