[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56576.1
DDBJ      :             protein translocase subunit secB
Swiss-Prot:SECB_NITOC   RecName: Full=Protein-export protein secB;

Homologs  Archaea  0/68 : Bacteria  415/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.33.1
:164 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->144 1qynD PDBj 1e-34 51.6 %
:RPS:SCOP  16->144 1fx3A  d.33.1.1 * 1e-13 46.5 %
:HMM:SCOP  17->152 1qynA_ d.33.1.1 * 2.3e-50 54.5 %
:RPS:PFM   16->144 PF02556 * SecB 8e-30 53.5 %
:HMM:PFM   9->155 PF02556 * SecB 1.3e-59 51.1 139/149  
:BLT:SWISS 1->164 SECB_NITOC 9e-72 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56576.1 GT:GENE ABA56576.1 GT:PRODUCT protein translocase subunit secB GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 33751..34245 GB:FROM 33751 GB:TO 34245 GB:DIRECTION + GB:PRODUCT protein translocase subunit secB GB:PROTEIN_ID ABA56576.1 GB:DB_XREF GI:76881895 InterPro:IPR003708 LENGTH 164 SQ:AASEQ MAEDSTNQQTSEQGQQAQFAIQKIYVKDLSFETPNSPHIFNQEQEWKPEFNLQLSNKNQRIAENVHEVVLSLTVTAKLGDQTAFLVEVHQAGIFMLNGYGEESLGSLLGSYCPNILFPFAREVVADLVTKGGFPPLLLAPVNFDALYAQQQQQRQSAGAAEVRH GT:EXON 1|1-164:0| SW:ID SECB_NITOC SW:DE RecName: Full=Protein-export protein secB; SW:GN Name=secB; OrderedLocusNames=Noc_0034; SW:KW Chaperone; Complete proteome; Cytoplasm; Protein transport;Translocation; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->164|SECB_NITOC|9e-72|100.0|164/164| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0055085|"GO:transmembrane transport"|Translocation| GO:SWS GO:0006810|"GO:transport"|Transport| SEG 98->111|gygeeslgsllgsy| SEG 145->160|alyaqqqqqrqsagaa| BL:PDB:NREP 1 BL:PDB:REP 19->144|1qynD|1e-34|51.6|124/136| RP:PFM:NREP 1 RP:PFM:REP 16->144|PF02556|8e-30|53.5|127/146|SecB| HM:PFM:NREP 1 HM:PFM:REP 9->155|PF02556|1.3e-59|51.1|139/149|SecB| GO:PFM:NREP 3 GO:PFM GO:0015031|"GO:protein transport"|PF02556|IPR003708| GO:PFM GO:0051082|"GO:unfolded protein binding"|PF02556|IPR003708| GO:PFM GO:0051262|"GO:protein tetramerization"|PF02556|IPR003708| RP:SCP:NREP 1 RP:SCP:REP 16->144|1fx3A|1e-13|46.5|127/143|d.33.1.1| HM:SCP:REP 17->152|1qynA_|2.3e-50|54.5|134/134|d.33.1.1|1/1|Bacterial protein-export protein SecB| OP:NHOMO 427 OP:NHOMOORG 417 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111111111111111111111111111111111111111111--1111111111111111111111111111111111-1111111111111111111111111111111111111111111111111211111111111111111111111111----1-------------1--------------------------------------11111111111111111111111111111111--111111--11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111-111111111111111111111111111111111111111111111111111111111111122222222211111111111111111111111111111--1-------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 78.0 SQ:SECSTR ##############cccEEEEEEEEEEEEEEEcTTTTGGG##GcccccEEEEEEEEEEEEEETTEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEcccHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHTTccccccccccHH#################### DISOP:02AL 3-17, 148-164| PSIPRED ccccccccccccccccccEEEEEEEEEEEEccccccHHHHHccccccccEEEEEEEccEEccccEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccc //