[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56589.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:249 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56589.1 GT:GENE ABA56589.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 46609..47358 GB:FROM 46609 GB:TO 47358 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56589.1 GB:DB_XREF GI:76881908 LENGTH 249 SQ:AASEQ MSNSIGRPLPNCRHLRSLPLPSIAQYWAIETGTNPSDNLRDLAFAVHCWLLCEKEFRSAYRKSGDPKFLEAVLPNNKEKLEQIGEALKKLYLDNILDAQIEQTLAAITIYAEDIKDWCQRNHRPLPRFWFPLSEAAASHESGSYQPSPKKLIAEAEEVGKNLSGVLKASDKMPVDPPRKRSLIIPSTANQYNTKDKKSYLNIELVRRTYDHLCETQKDRHLAPKEELAFVINKPAHFDTDKIIELYLNL GT:EXON 1|1-249:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 136-151| PSIPRED cccccccccccHHHHHcccccHHHHHHEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccHHHHHHccccccccccHHHHHHHHHHHccHHHHHHHcccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHcc //