[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56594.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:199 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   85->107 PF06855 * DUF1250 0.00065 26.1 23/46  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56594.1 GT:GENE ABA56594.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 49434..50033 GB:FROM 49434 GB:TO 50033 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56594.1 GB:DB_XREF GI:76881913 LENGTH 199 SQ:AASEQ MKKTGNGGRSQSSRYQLPLAQDKALPLAPENGAHRGGVSPPKRCQARQLNGAAQGTGIEQTREQTNLYTAPADAAGTKSGLKGDDFPRQETAPRAVEAYLTKQGKRLQGQALRRFEIFWQVFDYRRGKAEAADAWWKLEPMDPGLLKAIIAGAQREASERPAKLEKGLTPKMAQGWLSGRRWEDAPPRRSAPTKPKLVV GT:EXON 1|1-199:0| HM:PFM:NREP 1 HM:PFM:REP 85->107|PF06855|0.00065|26.1|23/46|DUF1250| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15, 34-37, 41-42, 154-168, 193-194| PSIPRED ccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHcccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccccc //