[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56604.1
DDBJ      :             PilT-like protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   19->173 3dboB PDBj 1e-05 17.8 %
:RPS:SCOP  19->173 2fe1A1  c.120.1.1 * 4e-10 18.0 %
:HMM:SCOP  19->179 1w8iA_ c.120.1.1 * 3.6e-14 25.8 %
:HMM:PFM   19->171 PF01850 * PIN 3e-12 29.1 117/126  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56604.1 GT:GENE ABA56604.1 GT:PRODUCT PilT-like protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 64087..64638 GB:FROM 64087 GB:TO 64638 GB:DIRECTION + GB:PRODUCT PilT-like protein GB:PROTEIN_ID ABA56604.1 GB:DB_XREF GI:76881923 InterPro:IPR002716 LENGTH 183 SQ:AASEQ MKNKAYDLSSYSFSSDEQVLVDTNVWLYLFPAPGNPPHNFAQQYSTAFANLVSAQARPVLDPMVLSEYLNRYIRIEWEGHYRSHYPKFKDFRNSADFSTVASSAETFAKRILSFCQIHSIPANELDLNQALSDFSTGGVDFNDALLVDICKKRNIKLMTNDGDFQDGGIEVLTTNPRLLRACP GT:EXON 1|1-183:0| RP:PDB:NREP 1 RP:PDB:REP 19->173|3dboB|1e-05|17.8|118/126| HM:PFM:NREP 1 HM:PFM:REP 19->171|PF01850|3e-12|29.1|117/126|PIN| RP:SCP:NREP 1 RP:SCP:REP 19->173|2fe1A1|4e-10|18.0|128/130|c.120.1.1| HM:SCP:REP 19->179|1w8iA_|3.6e-14|25.8|132/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN --------------------------------------------------111--------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------1-----------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 64.5 SQ:SECSTR ##################EEEccGGGccccc##GGGccc#################EEEEEHHHHHHHHHHHHHcccHH############HHHHHHHHHHTT###TTccEEcccHHHHHHHHHHHHHHHHHTc###cccHHHHHHHHHHHHTTccEEEccccGGGTTccEEE########## DISOP:02AL 1-5| PSIPRED cccccccccccccccccEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHccHHHcccHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHEEEEccccEEEEEccccHHHHcEEEEEccHHHHcccc //