[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56608.1
DDBJ      :             TrfA-related protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:278 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   36->254 PF07042 * TrfA 1e-55 48.9 %
:HMM:PFM   32->271 PF07042 * TrfA 1.3e-43 33.9 239/282  
:BLT:SWISS 39->273 TRFA_ECOLX 8e-36 34.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56608.1 GT:GENE ABA56608.1 GT:PRODUCT TrfA-related protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(70800..71636) GB:FROM 70800 GB:TO 71636 GB:DIRECTION - GB:PRODUCT TrfA-related protein GB:PROTEIN_ID ABA56608.1 GB:DB_XREF GI:76881927 InterPro:IPR010751 LENGTH 278 SQ:AASEQ MEHITNKIARMAQEAKTRREAKAKREAETAKIIPLLPCWGKGQRGVPNEMVRSALFSVKNKKQARAYLEGVPIVVVGDGRISYRGQELRQDDEDIWLQIMHEAKARPLGKCVEFKPYALLKGVGWAIKGQSYQRLQISLERMVATALTVSSHRLGKSVTLPLIQKFERDHGRGPWKVWISSEMVVLFGDVHYTRLEWAMRHQLGPIAKWLHGLYSSHARPYPMKVETLWKGSGSADGLLKTFKVNLKGALNELKAVDFLSDWRIEGNLVYVMRAEKKA GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 39->273|TRFA_ECOLX|8e-36|34.9|235/100| SEG 14->31|eaktrreakakreaetak| RP:PFM:NREP 1 RP:PFM:REP 36->254|PF07042|1e-55|48.9|219/248|TrfA| HM:PFM:NREP 1 HM:PFM:REP 32->271|PF07042|1.3e-43|33.9|239/282|TrfA| OP:NHOMO 30 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11-12----1----------1--1----------1--411-2--21-------------1--------1-------------1-1--1--------------------------------------------------------------------1--------------------------------------------------------------------------------1----------------------------------------------------------1-------1------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccEEEEEEEHHHHccHHHHHHHHHHHHHccccccEEEEEHHHHHEEcccccccccHHHHHHHHHHHcccEEEEEEEccccEEEEHHHHHHcccccccEEEEEEcHHHEEEEcccccEEEcHHHHHHHHHHHHHHHHHHHHccccccEEHEEHHccccccHHHHHHHHHHHHHHHHHHHHccccccEEEccEEEEEEEccccc //