[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56621.1
DDBJ      :             Protein of unknown function DUF497
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->94 PF04365 * DUF497 3e-12 47.4 %
:HMM:PFM   14->91 PF04365 * DUF497 7.5e-28 44.2 77/80  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56621.1 GT:GENE ABA56621.1 GT:PRODUCT Protein of unknown function DUF497 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 89460..89768 GB:FROM 89460 GB:TO 89768 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF497 GB:PROTEIN_ID ABA56621.1 GB:DB_XREF GI:76881940 InterPro:IPR007460 LENGTH 102 SQ:AASEQ MGYPHSMNESHFEWDEAKNTANQRKHGVSFYEAQYAFLDPKRVIAEDLSHSQNEKRYYCFGTNREGTGIITVRFTYRSGRIRIIGAGYWRKGKKVYEQANSV GT:EXON 1|1-102:0| RP:PFM:NREP 1 RP:PFM:REP 14->94|PF04365|3e-12|47.4|76/79|DUF497| HM:PFM:NREP 1 HM:PFM:REP 14->91|PF04365|7.5e-28|44.2|77/80|DUF497| OP:NHOMO 20 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- --1---------------------------------------------------------------------------------------------------------------------------11-----1-----11------11---2---------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------------------------------------------------------11--1------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 92-102| PSIPRED cccEEccccccEEEcHHHHHHHHHHccccHHHHHHHHccccEEEEEcccccccccEEEEEEEEccccEEEEEEEEEEccEEEEEEEccccHHHHHHHHHccc //