[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56630.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->128 3ct8A PDBj 6e-10 37.0 %
:RPS:PDB   1->136 3ct8A PDBj 8e-10 28.1 %
:RPS:SCOP  1->141 1sp9A  d.32.1.3 * 1e-08 9.7 %
:HMM:SCOP  1->142 1kw3B2 d.32.1.3 * 1.4e-13 21.9 %
:HMM:PFM   5->136 PF00903 * Glyoxalase 2e-07 22.5 120/128  
:BLT:SWISS 6->128 YQJT_BACSU 1e-04 29.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56630.1 GT:GENE ABA56630.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 97494..98048 GB:FROM 97494 GB:TO 98048 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56630.1 GB:DB_XREF GI:76881949 LENGTH 184 SQ:AASEQ MRFKGVHHIEFSVLNYEESIRFFDQMFGWLGYRSFWTLDIGYRSTYYMARFPFFHSYIGIQPAKTGNKLVHVDRTTGVHHIALWARNRKEVDDFHMEFLLKNNIAVTNPPSEYPTYTPGYYAVFFNDPITGIHFELSHTPMLPSLSSYLAWIRALKNIWRKHPEWKAPPWKESMRKLPSRHEQA GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 6->128|YQJT_BACSU|1e-04|29.2|113/100| BL:PDB:NREP 1 BL:PDB:REP 3->128|3ct8A|6e-10|37.0|108/132| RP:PDB:NREP 1 RP:PDB:REP 1->136|3ct8A|8e-10|28.1|128/132| HM:PFM:NREP 1 HM:PFM:REP 5->136|PF00903|2e-07|22.5|120/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->141|1sp9A|1e-08|9.7|134/362|d.32.1.3| HM:SCP:REP 1->142|1kw3B2|1.4e-13|21.9|128/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ------------------------1------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-111111------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1---------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 164 STR:RPRED 89.1 SQ:SECSTR TTTTTccEEEEEEccHHHHHHHHHHHHHHTTcEcEEEEETTEEEEEETTEEEEEEEccGGGccTTTcTccccTTcccccEEEEEcccHHHHHHHHHHHHHHHTcccccTTTTTcTTcTTccEEEEEcT#TccEEEEEEcccccccHHHHHEEEcTTccccccTTc################### DISOP:02AL 173-184| PSIPRED cccccEEEEEEEcccHHHHHHHHHHHHHHccHHHHHccccccEEEEcccccEEEcccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEcccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccc //