[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56639.1
DDBJ      :             Protein of unknown function DUF924
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  197/915 : Eukaryota  26/199 : Viruses  0/175   --->[See Alignment]
a.118.8
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->179 2i6hB PDBj 6e-16 30.3 %
:RPS:SCOP  9->178 2i6hA1  a.118.8.5 * 1e-46 35.1 %
:RPS:PFM   11->177 PF06041 * DUF924 5e-42 50.3 %
:HMM:PFM   11->180 PF06041 * DUF924 2.3e-64 47.1 170/179  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56639.1 GT:GENE ABA56639.1 GT:PRODUCT Protein of unknown function DUF924 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(108238..108792) GB:FROM 108238 GB:TO 108792 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF924 GB:PROTEIN_ID ABA56639.1 GB:DB_XREF GI:76881958 InterPro:IPR010323 LENGTH 184 SQ:AASEQ MLLNSMHHQQIIDFWFKEIKPESWWKKIPHFDQLIKERFKAHHRAAVQGELYEWRREPFGRLAEIIILDQFSRNIYRNHPLSFAYDTAALILSQEAIDKNVGKMLNSEHKIFLYMPFMHSESLKIHQIGIKLFAEPGLESQYDCEIKHQAIITRFGRYPHRNQILERPSTPAEIAFLKKADSSF GT:EXON 1|1-184:0| BL:PDB:NREP 1 BL:PDB:REP 11->179|2i6hB|6e-16|30.3|165/174| RP:PFM:NREP 1 RP:PFM:REP 11->177|PF06041|5e-42|50.3|167/180|DUF924| HM:PFM:NREP 1 HM:PFM:REP 11->180|PF06041|2.3e-64|47.1|170/179|DUF924| RP:SCP:NREP 1 RP:SCP:REP 9->178|2i6hA1|1e-46|35.1|168/179|a.118.8.5| OP:NHOMO 241 OP:NHOMOORG 223 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1-12-----111111111--2---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------1--111-----1111-111111---1--1--111-111-11111113-11111121111111--------------11-----------------------------11-11-11111111111-111111111-11112111111--2111-111111-1-1111---1---------1--11----------------------------1----------------------------1111-111111--11111111111-1-11-11---1--1--------------------------------------------------1----------------1---------1--------------111111-----1311---------------1111111-11-12222211-111111-------------1--1-----111111111111------------------------------------------------------------------ ------2----------1-----1-11------111------------------------------------------------------------------1----1-3---------------------------------------------------------------2-11-1-11-111--11--111---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 89.7 SQ:SECSTR ##########HHHHH#HHHcHHHHTcccHHHHHHHHHHHHHHHHHHHTTccGGGGGcHHHHHHHHHH#THHHHHHcTT#cGGGTTHHHHHHHHHHHHHTTHHHHccHHHHGGGTHHHHHcccHHHHHHHHHHHTTTcHHHHHHHH#HHHHHHHHHcccGGGTTTTTccccHHHHHHHHc##### DISOP:02AL 1-6, 183-184| PSIPRED cccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHcHHHHHHHHHHHHHHcHHHccccHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccc //