[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56652.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:204 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   61->167 2e7sN PDBj 7e-04 25.2 %
:HMM:PFM   46->200 PF05262 * Borrelia_P83 0.00018 24.8 133/489  
:BLT:SWISS 33->165 PCNT_HUMAN 2e-04 26.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56652.1 GT:GENE ABA56652.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 127637..128251 GB:FROM 127637 GB:TO 128251 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56652.1 GB:DB_XREF GI:76881971 LENGTH 204 SQ:AASEQ MDIAKKFLPLPWRAQFLAFAALTVFALPLHAESGEAPSLTPAQMQEFHKLQQKMRTVGQQLDEIRQETLKTTPKLQEQQEEYQSLLFKTMKEQGSDPDPALARMREIEGQVQNEDLPEDERKQFIMEYQQKDAQLQQASRDAMQDEKVRKMAESLSQDTVAAMREQDPKTEELLREMEQLREEMQGIVAKIKPKPQAGSGSSSE GT:EXON 1|1-204:0| BL:SWS:NREP 1 BL:SWS:REP 33->165|PCNT_HUMAN|2e-04|26.7|131/3336| SEG 14->27|aqflafaaltvfal| SEG 76->81|qeqqee| SEG 171->185|eellremeqlreemq| BL:PDB:NREP 1 BL:PDB:REP 61->167|2e7sN|7e-04|25.2|107/110| HM:PFM:NREP 1 HM:PFM:REP 46->200|PF05262|0.00018|24.8|133/489|Borrelia_P83| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 52.5 SQ:SECSTR ############################################################cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc##################################### DISOP:02AL 1-3, 108-118, 130-149, 162-165, 192-204| PSIPRED ccHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //