[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56656.1
DDBJ      :             Conserved hypothetical protein 46
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  710/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
b.122.1c.116.1
:243 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->243 1nxzB PDBj 3e-43 43.3 %
:RPS:PDB   4->224 2egvA PDBj 2e-47 25.1 %
:RPS:SCOP  2->71 1nxzA1  b.122.1.2 * 5e-14 44.3 %
:RPS:SCOP  75->243 1nxzA2  c.116.1.5 * 1e-37 42.0 %
:HMM:SCOP  2->73 1nxzA1 b.122.1.2 * 1.7e-17 40.3 %
:HMM:SCOP  74->243 1nxzA2 c.116.1.5 * 1.2e-53 42.4 %
:RPS:PFM   30->224 PF04452 * Methyltrans_RNA 7e-36 47.7 %
:HMM:PFM   18->237 PF04452 * Methyltrans_RNA 1.6e-71 43.2 220/225  
:BLT:SWISS 1->222 RSME_SHIFL 2e-49 43.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56656.1 GT:GENE ABA56656.1 GT:PRODUCT Conserved hypothetical protein 46 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 130896..131627 GB:FROM 130896 GB:TO 131627 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein 46 GB:PROTEIN_ID ABA56656.1 GB:DB_XREF GI:76881975 InterPro:IPR004382 InterPro:IPR006700 LENGTH 243 SQ:AASEQ MRVPRVYFPLSLSIGSSVSLDERALQYVIRVLRLRLGAQLRLFDGRGAEYQAVLETIEKRAVKVRILERIEHHVESPLHIILGQGISRGERMDYALQKAVELGVSRIIPLLTERSAVNLSAERAEKRLRHWQGVIISACEQCGRNYIPPVDTPRPLADFLRDDHRGLAVLLDPRSRRPLKALPLPLDNRLIVLIGPEGGLNKGEAKQAQQADFIGVCLGPRILRTETATVAALTALQLLWGDL GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 1->222|RSME_SHIFL|2e-49|43.4|221/243| SEG 225->239|tetatvaaltalqll| BL:PDB:NREP 1 BL:PDB:REP 2->243|1nxzB|3e-43|43.3|238/241| RP:PDB:NREP 1 RP:PDB:REP 4->224|2egvA|2e-47|25.1|211/229| RP:PFM:NREP 1 RP:PFM:REP 30->224|PF04452|7e-36|47.7|195/225|Methyltrans_RNA| HM:PFM:NREP 1 HM:PFM:REP 18->237|PF04452|1.6e-71|43.2|220/225|Methyltrans_RNA| GO:PFM:NREP 2 GO:PFM GO:0006364|"GO:rRNA processing"|PF04452|IPR006700| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF04452|IPR006700| RP:SCP:NREP 2 RP:SCP:REP 2->71|1nxzA1|5e-14|44.3|70/72|b.122.1.2| RP:SCP:REP 75->243|1nxzA2|1e-37|42.0|169/174|c.116.1.5| HM:SCP:REP 2->73|1nxzA1|1.7e-17|40.3|72/72|b.122.1.2|1/1|PUA domain-like| HM:SCP:REP 74->243|1nxzA2|1.2e-53|42.4|170/174|c.116.1.5|1/1|alpha/beta knot| OP:NHOMO 722 OP:NHOMOORG 717 OP:PATTERN -------------------------------------------------------------------- 111-1111-------11-------11-----1111111111--1----11111111-1--1111----1-11111----11-11-1111111-111---1111-111--1--------------111111111111111-1---1111111111111111---111111-1-1-1---1-11-111--111111---------------111111---1111111111-1111111111111111111111111-1-11-1-----111111111-11111111111--111111111111111111111111111111111-11111111111111111111111111-11111111111111111-111-11211111111111111111111111----------1-11-1111-11111111111111111111--11111--11111111111111-111111111111-1111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---111111112111111111-------------------------111-1111111111111111111111111111--111111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--111-1111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111-12-----11----------1----1-11-1---1111---1----11---111-1111 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1112-11--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 242 STR:RPRED 99.6 SQ:SECSTR #cccEEEcccEcTETTEEEEETHHHHHHHHHTTccTTccEEEEETTTEEEEEEEEEEcccEEEEEEEEEcccccccccEEEEEEEccccTHHHHHHHHHHHHTccEEEEEEcTTccccHcHHHHHHHHHHHHHHHHHHHHHHTcccccEEcccEEGGGcccccEEEEEcTTcccccGGGccTTcTcccEEEEEEccTTcccHHHHHHHHHTTcEEEccccccccHHHHHHHHHHHHHHHTccT DISOP:02AL 243-244| PSIPRED ccccEEEccHHHccccEEEEcHHHHHHHHHHcccccccEEEEEEccccEEEEEEEEEcccEEEEEEEEcccccccccccEEEEEEEccccHHHHHHHHHHHccccEEEEEEEccEEEccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcccccEEEEEccccccccccccccccccEEEEEcccccccHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHHccc //