[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56670.1
DDBJ      :             Protein of unknown function DUF28
Swiss-Prot:Y137_NITOC   RecName: Full=UPF0082 protein Noc_0137;

Homologs  Archaea  0/68 : Bacteria  881/915 : Eukaryota  153/199 : Viruses  0/175   --->[See Alignment]
e.39.1
:248 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->247 1konA PDBj 2e-71 56.7 %
:RPS:SCOP  3->247 1konA  e.39.1.1 * 2e-88 56.2 %
:HMM:SCOP  3->247 1konA_ e.39.1.1 * 3.3e-98 61.4 %
:RPS:PFM   5->237 PF01709 * DUF28 3e-60 58.6 %
:HMM:PFM   5->238 PF01709 * DUF28 5.4e-102 60.5 233/234  
:BLT:SWISS 1->248 Y137_NITOC e-131 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56670.1 GT:GENE ABA56670.1 GT:PRODUCT Protein of unknown function DUF28 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 150092..150838 GB:FROM 150092 GB:TO 150838 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF28 GB:PROTEIN_ID ABA56670.1 GB:DB_XREF GI:76881989 InterPro:IPR002876 LENGTH 248 SQ:AASEQ MAGHSKWANIQYRKGAQDAKRGKLFTRLIREITVAARLEGGDPATSPRLRTAIDKAFAANMPKDNIERAIKRGTGDLEGVAYEEVRYEGYGPYGVAVMVDCMTDNRNRTVAEIRHVFSKWGGNLGTDGSVAYLFSKKGIISYSKESNEDAIMEVAIEGGAEDVVTNEDSSIDVFTEPEEFSTVKKALDEAGLKAEQAEITQHASTSVSLALEEARKMLDFLDALEELDDVQQVYSNADFSEEILAQLG GT:EXON 1|1-248:0| SW:ID Y137_NITOC SW:DE RecName: Full=UPF0082 protein Noc_0137; SW:GN OrderedLocusNames=Noc_0137; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->248|Y137_NITOC|e-131|100.0|248/248| SEG 218->229|ldfldaleeldd| BL:PDB:NREP 1 BL:PDB:REP 3->247|1konA|2e-71|56.7|233/233| RP:PFM:NREP 1 RP:PFM:REP 5->237|PF01709|3e-60|58.6|232/234|DUF28| HM:PFM:NREP 1 HM:PFM:REP 5->238|PF01709|5.4e-102|60.5|233/234|DUF28| RP:SCP:NREP 1 RP:SCP:REP 3->247|1konA|2e-88|56.2|233/233|e.39.1.1| HM:SCP:REP 3->247|1konA_|3.3e-98|61.4|241/244|e.39.1.1|1/1|YebC-like| OP:NHOMO 1161 OP:NHOMOORG 1034 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111-1111--111121111111111111111111111111111111111111111111111111111111111111111111-1-----1----1111111111111111111111111111221211111111112222221111111111111111111111211111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111121112222121111111111111111111111111111111111111111111111111212111111111111111111111111111111111111121212222222222222222222--11111--1---11111112222222222-2222222222222222222111111112122222222222222122112221-111111111111--12111111111121211111111111111111111111111221111222222222222211111111111112111111111111111111111111111111111111111111111----1-11111111111-11111111111111111121 ------1-------1111111111111111111111111111111111111-1111-11111111111111-11111-1111111111--2111-11111---111-111112111--1111111211-121-11-11-111111----11--11--12---1-11-111-11222111111-11-1111141221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 98.8 SQ:SECSTR ##ccccGGGTcccTTTTTccHHHHHHHHHHHHHHHHHcccccGGGcTTTHHHHHHHHHTTccHHHHHHHHccccccccccccEEEEEEEEETTTEEEEEEEEEccHHHHHHHHHHHHHTTTcEEccTTccGGGEEEEEEEEEccGccHHHHHHHHHHHTccEEEEcTTccEEEEEEGGGHHHHHHHHHHTTccccEEEEEEEEcccccccTTTcHHHHHHHHHHHHcccEEEEEEcccccHHHHTTc# DISOP:02AL 3-4| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHccccccccEEEEEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHccccccccccHHHHccccEEEEEcccccHHHHHHHHHHcccccEEEccccEEEEEEcHHHHHHHHHHHHHcccEEEEEEEEEEccccccccHHHHHHHHHHHHHHcccccHHHHHccccccHHHHHHcc //