[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56678.1
DDBJ      :             TolB
Swiss-Prot:TOLB_NITOC   RecName: Full=Protein tolB;Flags: Precursor;

Homologs  Archaea  9/68 : Bacteria  536/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.68.4b.68.7c.51.2
:434 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->434 2w8bA PDBj 6e-93 42.9 %
:RPS:PDB   41->434 1c5kA PDBj e-123 42.9 %
:RPS:SCOP  41->165 1c5kA2  c.51.2.1 * 4e-39 36.8 %
:RPS:SCOP  167->434 1c5kA1  b.68.4.1 * 1e-24 45.9 %
:HMM:SCOP  35->165 1crzA2 c.51.2.1 * 2e-40 53.1 %
:HMM:SCOP  157->434 1k32A2 b.68.7.1 * 9.6e-62 35.5 %
:RPS:PFM   13->133 PF04052 * TolB_N 8e-22 47.1 %
:RPS:PFM   230->429 PF00930 * DPPIV_N 3e-08 30.1 %
:HMM:PFM   206->228 PF07676 * PD40 4.4e-07 34.8 23/39  
:HMM:PFM   247->278 PF07676 * PD40 1.8e-08 43.8 32/39  
:HMM:PFM   286->322 PF07676 * PD40 1.2e-15 54.1 37/39  
:HMM:PFM   331->353 PF07676 * PD40 0.0001 26.1 23/39  
:HMM:PFM   375->399 PF07676 * PD40 9.7e-05 20.0 25/39  
:HMM:PFM   15->133 PF04052 * TolB_N 2e-38 46.2 117/120  
:BLT:SWISS 1->434 TOLB_NITOC 0.0 100.0 %
:TM
:REPEAT 4|211->250|251->294|295->338|382->425

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56678.1 GT:GENE ABA56678.1 GT:PRODUCT TolB GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 155601..156905 GB:FROM 155601 GB:TO 156905 GB:DIRECTION + GB:PRODUCT TolB GB:PROTEIN_ID ABA56678.1 GB:DB_XREF GI:76881997 InterPro:IPR007195 InterPro:IPR011659 LENGTH 434 SQ:AASEQ MMNTRVWCKIIGMLALLVWLVSSPSVFAVLTIEITGGTEAALPIAIVPFQNEGSTPPENVAAVIAADLARSGRFAPLPEEDLISRPRNASDIQFQDWRRLGSEGLVIGKVISLGADRYEVRFQLFDIYKEEQLVGRRYQVPAAGLRHLAHQIADLIYETLTGEKGIFTTHIAFVTVSRAAHGAKQYSLQVADVDGHNPHTILRSKEPILSPAWSPDGTQLAYVSFERRRSEVFVQELRTGQRQSVASFSGINSAPDWSPDGGKLALVLSKEGNPEIYIRDLATGRLTRLTHNTAIDTEPAWAPDGGSIVFTSDRGGRPQLYQIPVSGGRAQRLTFDGAYNASASFAPDGRRLALIHGDKGQFHIAVLNLQSKELQVLTETRMDESPSFAPNGRMILYATSSPQGGVLAAVSTDGRVRQRLAQQGDEVREPAWSP GT:EXON 1|1-434:0| SW:ID TOLB_NITOC SW:DE RecName: Full=Protein tolB;Flags: Precursor; SW:GN Name=tolB; OrderedLocusNames=Noc_0145; SW:KW Complete proteome; Periplasm; Protein transport; Signal; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->434|TOLB_NITOC|0.0|100.0|434/434| GO:SWS:NREP 3 GO:SWS GO:0042597|"GO:periplasmic space"|Periplasm| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 1 TM:REGION 10->32| NREPEAT 1 REPEAT 4|211->250|251->294|295->338|382->425| BL:PDB:NREP 1 BL:PDB:REP 32->434|2w8bA|6e-93|42.9|401/409| RP:PDB:NREP 1 RP:PDB:REP 41->434|1c5kA|e-123|42.9|392/397| RP:PFM:NREP 2 RP:PFM:REP 13->133|PF04052|8e-22|47.1|119/121|TolB_N| RP:PFM:REP 230->429|PF00930|3e-08|30.1|196/332|DPPIV_N| HM:PFM:NREP 6 HM:PFM:REP 206->228|PF07676|4.4e-07|34.8|23/39|PD40| HM:PFM:REP 247->278|PF07676|1.8e-08|43.8|32/39|PD40| HM:PFM:REP 286->322|PF07676|1.2e-15|54.1|37/39|PD40| HM:PFM:REP 331->353|PF07676|0.0001|26.1|23/39|PD40| HM:PFM:REP 375->399|PF07676|9.7e-05|20.0|25/39|PD40| HM:PFM:REP 15->133|PF04052|2e-38|46.2|117/120|TolB_N| GO:PFM:NREP 4 GO:PFM GO:0015031|"GO:protein transport"|PF04052|IPR007195| GO:PFM GO:0042597|"GO:periplasmic space"|PF04052|IPR007195| GO:PFM GO:0006508|"GO:proteolysis"|PF00930|IPR002469| GO:PFM GO:0016020|"GO:membrane"|PF00930|IPR002469| RP:SCP:NREP 2 RP:SCP:REP 41->165|1c5kA2|4e-39|36.8|125/128|c.51.2.1| RP:SCP:REP 167->434|1c5kA1|1e-24|45.9|266/269|b.68.4.1| HM:SCP:REP 35->165|1crzA2|2e-40|53.1|130/0|c.51.2.1|1/1|TolB, N-terminal domain| HM:SCP:REP 157->434|1k32A2|9.6e-62|35.5|259/281|b.68.7.1|1/1|Tricorn protease N-terminal domain| OP:NHOMO 690 OP:NHOMOORG 549 OP:PATTERN -------------------------1111-----------------1--2122--------------- 26Q------------------------------------1-111----------1------2--111---------------1-----3311-311---1---1411-511111111111111111111111111122243---311-------------------11----------------------1--1-----------------11-1---1------------11----------------------------------------------------------------------------------------------------------------------1---------------------81-1114111111-1111111111111111111111-1111111111111222112111121123211111111111111111111111121111-------1111111111111111-111223311111111111111111111111111111111111111121211111111111111111-------21111112111111111111121111131145452111111111111111111111111111111111211132311111121112111113113--11211------1111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111112222111111111111111111111111111121111111111111111111111111111111111222221112222222212211111111---1111----------------------------------------------11- ------------------------3-----------------------------------------------------------------------------------------------------------------------------------------------------1-------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 431 STR:RPRED 99.3 SQ:SECSTR #EEccccG##GGGGGHHHHccTTccHHHHHHHHHHTcccEcEEEEEcccEEccccccccHHHHHHHHHHHTccEEEccGGGcccccccTTTccHHHHTTTTcccEEEEEEEEcTTccEEEEEEEEEccTTEEEEEEEEEEcGGGHHHHHHHHHHHHHHHHHcccccTTcEEEEEEEcccccccccEEEEEEETTccccEEEEEEcccEEEEEEcTTccEEEEEEcTTcccEEEEEETTTccEEEEEcccccEEEEEEcTTccEEEEEEcTTcccEEEEEETTTccEEEcccccccEEEEEEcTTccEEEEEEcTTcccEEEEEETTccccEEccccccEEEEEEEcTTccEEEEEEEETTEEEEEEEETTTccEEEcccccccEEEEEcTTccEEEEEEEETTEEEEEEEETTcccEEEccccccEEEEEEEcc DISOP:02AL 1-3, 82-89| PSIPRED cccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccEEEEcccccccccHHHHHHHHHHHHHcccEEEEEcccccccccccccccccHHHHHccccEEEEEEEEEcccccEEEEEEEEEccccEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEcccccccccccEEEEEEccccEEEEEEccccEEEEEEEcccccEEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEEcccccccEEEEcccccEEEEEEcccccEEEEEEEccccEEEEEEccccEEEEEEEcccccEEEEEEccccEEEEEEEEccccEEEEEEccccccEEEEcccccEEEEEEEcccccEEEEEEccccEEEEEEccccEEEEEEEcc //