[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56683.1
DDBJ      :             Outer membrane efflux protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.5.1
:415 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   84->411 3d5kA PDBj 2e-23 15.3 %
:RPS:SCOP  92->411 1wp1A  f.5.1.1 * 2e-24 15.7 %
:HMM:SCOP  33->411 1ek9A_ f.5.1.1 * 4.1e-63 31.0 %
:RPS:PFM   90->214 PF02321 * OEP 3e-06 23.2 %
:HMM:PFM   36->214 PF02321 * OEP 6.4e-16 27.4 179/188  
:HMM:PFM   237->411 PF02321 * OEP 3.3e-22 28.7 174/188  
:HMM:PFM   183->262 PF00758 * EPO_TPO 0.00038 20.3 79/184  
:BLT:SWISS 29->411 CZCC_RALME 3e-19 24.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56683.1 GT:GENE ABA56683.1 GT:PRODUCT Outer membrane efflux protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 160371..161618 GB:FROM 160371 GB:TO 161618 GB:DIRECTION + GB:PRODUCT Outer membrane efflux protein GB:PROTEIN_ID ABA56683.1 GB:DB_XREF GI:76882002 InterPro:IPR003423 LENGTH 415 SQ:AASEQ MRPVIVISSYLLSCGGLILALTYSTIGAAAYTLTLEDVLALAQGNPNIVAAQAQQDAASAALQTARAYPNPEAQLMAGPSKALAPGTPGGLSAFAQIAQPIELPSVRSSRARGAMAGLETAQAATSNVSLAILAQAKQAFYEILRRQNEAEVAIQNQALLEQIRDRVKLRVETGEAPRYEFVKAEAEVLSAIKNRERAQLQINSAKSMLRALIGASLPIDFEAKGKLAVPKDVPSVEKLRSLVLERHPAIIQIQGQMRQAQAQLRLEQNLRYPQPTFMASFQRAPDLDQWLFGFAIPLPLWNQRQGPIAAAAAELKQSEAAAEQQRLVLLREIEIAHTRYRIAARQEEAFETGLLKEAEYALKVAETAYRQGARGILDYLDAQRIYQTVRQDYINARFDKQMAYIEIERLLASDL GT:EXON 1|1-415:0| BL:SWS:NREP 1 BL:SWS:REP 29->411|CZCC_RALME|3e-19|24.7|376/418| TM:NTM 2 TM:REGION 11->33| TM:REGION 81->103| SEG 50->67|aaqaqqdaasaalqtara| SEG 249->271|aiiqiqgqmrqaqaqlrleqnlr| SEG 309->325|aaaaaelkqseaaaeqq| RP:PDB:NREP 1 RP:PDB:REP 84->411|3d5kA|2e-23|15.3|327/454| RP:PFM:NREP 1 RP:PFM:REP 90->214|PF02321|3e-06|23.2|125/189|OEP| HM:PFM:NREP 3 HM:PFM:REP 36->214|PF02321|6.4e-16|27.4|179/188|OEP| HM:PFM:REP 237->411|PF02321|3.3e-22|28.7|174/188|OEP| HM:PFM:REP 183->262|PF00758|0.00038|20.3|79/184|EPO_TPO| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF02321|IPR003423| GO:PFM GO:0006810|"GO:transport"|PF02321|IPR003423| RP:SCP:NREP 1 RP:SCP:REP 92->411|1wp1A|2e-24|15.7|319/456|f.5.1.1| HM:SCP:REP 33->411|1ek9A_|4.1e-63|31.0|377/428|f.5.1.1|1/1|Outer membrane efflux proteins (OEP)| OP:NHOMO 58 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- 1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-31-3------------------------------------------------------------------------------------------------------------1-1111------11-------11--1213--121---1-1-----33--321---------221--1----------------1-1-11---------1------------------------------------------------------------1---------------------------------------------------------------------------------------------------------1---------------------------------------1--------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 343 STR:RPRED 82.7 SQ:SECSTR ####################################################################GccEEEEEEEEEEEEcEEEEEEEEEEEEEEEEEcTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccTTccccccTTcccccccccccGGGHHHHcHHHHHHHHHHHHHHHHHHHHHTTcccEEEEEEEEEEETTcEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH#### DISOP:02AL 84-88| PSIPRED ccEEEHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //