[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56687.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:259 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->113 1g6q1 PDBj 3e-05 28.4 %
:RPS:PDB   85->243 1eizA PDBj 3e-08 15.5 %
:RPS:SCOP  69->225 2fpoA1  c.66.1.46 * 3e-10 11.3 %
:HMM:SCOP  34->218 1ne2A_ c.66.1.32 * 1.9e-13 21.6 %
:HMM:PFM   87->187 PF08241 * Methyltransf_11 6.1e-09 23.4 94/95  
:HMM:PFM   69->103 PF10294 * Methyltransf_16 0.00014 25.7 35/169  
:BLT:SWISS 40->113 HMT1_YEAST 1e-04 28.4 %
:BLT:SWISS 86->137 MTL10_MOUSE 8e-06 46.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56687.1 GT:GENE ABA56687.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 166595..167374 GB:FROM 166595 GB:TO 167374 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56687.1 GB:DB_XREF GI:76882006 InterPro:IPR000051 LENGTH 259 SQ:AASEQ MRKRYRIQFPKAKLSSCKQDEAYFYLQEENGRRKIRFHDYSEIYQKQDLYEQIFYERLQCSSPSKVSSILEAAVKQSQDNFSELRILDLGAGNGMMGDELKKHGVSRLIGIDIVPEAYEATIRDRPGIYDAYYVEDFTRLDNDKKEEIKTWNCDCMVTVSALGFSDIPAKVFIEAFNIIKNEGWLAFNIKETFFNISDESGFSKMIRELIFSKYIDIYCIERYRHRFSIDGEPLYYFAVAGRKNLDIPSNFLDSKNILA GT:EXON 1|1-259:0| BL:SWS:NREP 2 BL:SWS:REP 40->113|HMT1_YEAST|1e-04|28.4|67/348| BL:SWS:REP 86->137|MTL10_MOUSE|8e-06|46.2|52/244| BL:PDB:NREP 1 BL:PDB:REP 40->113|1g6q1|3e-05|28.4|67/328| RP:PDB:NREP 1 RP:PDB:REP 85->243|1eizA|3e-08|15.5|148/180| HM:PFM:NREP 2 HM:PFM:REP 87->187|PF08241|6.1e-09|23.4|94/95|Methyltransf_11| HM:PFM:REP 69->103|PF10294|0.00014|25.7|35/169|Methyltransf_16| RP:SCP:NREP 1 RP:SCP:REP 69->225|2fpoA1|3e-10|11.3|151/177|c.66.1.46| HM:SCP:REP 34->218|1ne2A_|1.9e-13|21.6|171/197|c.66.1.32|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 247 STR:RPRED 95.4 SQ:SECSTR HcHHHHHHHcTTcGTTTccccccccccccccHHHHGGGGcccccccccccGGGccccTTTcccHHHHHHHHHHTTccTTHHcccEEEEEccTTcHHHHHHHHHTTcEEEEEEcccccccTTEEEccTTcHHHHHHHHHHHcEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEHHHEEEccTTHHHHHHHHHHHTcEEEEEEEEEEEEccTTccTTccEEEEEEEEEccEEE############ DISOP:02AL 1-4, 14-16| PSIPRED ccccEEEEcHHHHHHcccHHHHHHHHHHccccccEEEccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccEEEEEEccccHHHHHHHHccccEEEEEEccHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccEEEEHHHHHHcccHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHHHHccccEEEEEcccEEEcccccHHHHHHHHHHHHHcccccccccccccc //