[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56715.1
DDBJ      :             Protein of unknown function DUF598
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  90/915 : Eukaryota  31/199 : Viruses  0/175   --->[See Alignment]
c.103.1
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->141 2k2eA PDBj 9e-20 45.0 %
:RPS:PDB   13->143 3cpkA PDBj 2e-17 43.4 %
:RPS:SCOP  10->142 2fi9A1  c.103.1.1 * 1e-21 28.2 %
:HMM:SCOP  1->145 2fvtA1 c.103.1.1 * 6e-30 38.2 %
:RPS:PFM   54->141 PF04430 * DUF498 9e-15 44.3 %
:HMM:PFM   48->142 PF04430 * DUF498 6e-33 45.3 95/110  
:BLT:SWISS 59->141 NDUF3_BOVIN 2e-12 38.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56715.1 GT:GENE ABA56715.1 GT:PRODUCT Protein of unknown function DUF598 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 201743..202186 GB:FROM 201743 GB:TO 202186 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF598 GB:PROTEIN_ID ABA56715.1 GB:DB_XREF GI:76882034 InterPro:IPR006729 LENGTH 147 SQ:AASEQ MKFSLDERTDVYTVSAYGSGYVEFRIPVSSEKEPERLQGEGLKENRGRQKICRNVVVSPGRLQEWSPASFSELEKAHFQAFLEMEPEVVVVGTGEQSHFLSPRLIEPLLRHQIGVEFMDTAAACRTYNILVGEGRRVVAALFIIRQP GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 59->141|NDUF3_BOVIN|2e-12|38.6|83/184| BL:PDB:NREP 1 BL:PDB:REP 1->141|2k2eA|9e-20|45.0|129/158| RP:PDB:NREP 1 RP:PDB:REP 13->143|3cpkA|2e-17|43.4|106/115| RP:PFM:NREP 1 RP:PFM:REP 54->141|PF04430|9e-15|44.3|88/110|DUF498| HM:PFM:NREP 1 HM:PFM:REP 48->142|PF04430|6e-33|45.3|95/110|DUF498| RP:SCP:NREP 1 RP:SCP:REP 10->142|2fi9A1|1e-21|28.2|110/118|c.103.1.1| HM:SCP:REP 1->145|2fvtA1|6e-30|38.2|123/0|c.103.1.1|1/1|MTH938-like| OP:NHOMO 135 OP:NHOMOORG 121 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1---------111111111111-111111111111111111111111111111111111111121111-------21111----------------------------------------------------------11---------------------------------1111---------------------------------------------------------------------------------------------11111--------------------------------------------------------------1--------------11111111111111----------------------------------------------------------- ------------------------------------------------------------------------------------------1-------------------1-----1--11-1111-21635-1111--111-11----11--11---1------------------------------------111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 98.0 SQ:SECSTR ccccccccTTcccEEEEETTEEEETTccEEcccTTcccHHHHHHHTTTEEEcccEEEcccccEEcccccGGGccHHHHHHHHTccccEEEEEcTTccccccHHHHHHHHTTTcEEEEEcHHHHHHHHHHHHHTTccEEEEEccc### DISOP:02AL 1-4| PSIPRED ccccccccccccEEEEEccccEEEEEEccccccEEEEcccccEEEcccEEEEccEEEEcccEEEccccccccccHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHcccEEEEEccHHHHHHHHHHHHcccEEEEEEEEEEcc //