[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56728.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:185 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 46->88 WZYE_ENTS8 5e-04 37.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56728.1 GT:GENE ABA56728.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 214478..215035 GB:FROM 214478 GB:TO 215035 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56728.1 GB:DB_XREF GI:76882047 LENGTH 185 SQ:AASEQ MRGVGDNSLTADLQLVSDDFTGQNSGQSILASCETAADVKVPKKDTLDDRPAWEFSTSLIEYYADTEIVGVAMLADDFHLQVISTGWPKITPQAIPLLIICRLWSAATRLPICHARAPVPPPPIITPTTGRTLSPSSTMAGHPIPPITVTAERLRFALGGRPRYGKNRYIANRVKGLYSKRAMGL GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 46->88|WZYE_ENTS8|5e-04|37.2|43/100| SEG 118->129|pvppppiitptt| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccccccccEEEEEEEccccccccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHccccEEEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEcccccccccEEccccccEEcccccccccccccEEEEHHHHHHHHcccccccccHHHHHHHHHHHHHHHccc //