[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56745.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.137.1
:85 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  3->69 1sg5A1  b.137.1.2 * 1e-04 30.2 %
:HMM:SCOP  1->84 1sg5A1 b.137.1.2 * 1.6e-13 31.2 %
:HMM:PFM   6->70 PF07073 * ROF 0.0007 25.4 63/80  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56745.1 GT:GENE ABA56745.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(239445..239702) GB:FROM 239445 GB:TO 239702 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56745.1 GB:DB_XREF GI:76882064 LENGTH 85 SQ:AASEQ MPDYIPINCNFHDQLEALATLRKQCHIFYQTMDGKIIETLDTITDIYTKNQEEFTVLGSGEIIRLDRLLEVDGQSYLEMKTSGDS GT:EXON 1|1-85:0| HM:PFM:NREP 1 HM:PFM:REP 6->70|PF07073|0.0007|25.4|63/80|ROF| RP:SCP:NREP 1 RP:SCP:REP 3->69|1sg5A1|1e-04|30.2|63/86|b.137.1.2| HM:SCP:REP 1->84|1sg5A1|1.6e-13|31.2|80/0|b.137.1.2|1/1|Rof/RNase P subunit-like| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------1----------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 82-85| PSIPRED cccEEEEEccHHHHHHHHHHHHHHHHEEEEEcccHHHHHHHHHHHHHccccccEEEEccccEEEEEEEEEcccccEEEEEccccc //