[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56750.1
DDBJ      :             SSU ribosomal protein S6P
Swiss-Prot:RS6_NITOC    RecName: Full=30S ribosomal protein S6;

Homologs  Archaea  0/68 : Bacteria  618/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.58.14
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->100 1vs5F PDBj 4e-36 65.0 %
:RPS:PDB   1->96 2bxjA PDBj 1e-31 28.1 %
:RPS:SCOP  1->100 1vs5F1  d.58.14.1 * 2e-32 65.0 %
:HMM:SCOP  1->104 1vmbA_ d.58.14.1 * 3e-33 44.2 %
:RPS:PFM   3->91 PF01250 * Ribosomal_S6 1e-23 51.7 %
:HMM:PFM   2->91 PF01250 * Ribosomal_S6 2.7e-34 40.0 90/92  
:BLT:SWISS 1->156 RS6_NITOC 4e-76 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56750.1 GT:GENE ABA56750.1 GT:PRODUCT SSU ribosomal protein S6P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 244005..244475 GB:FROM 244005 GB:TO 244475 GB:DIRECTION + GB:PRODUCT SSU ribosomal protein S6P GB:PROTEIN_ID ABA56750.1 GB:DB_XREF GI:76882069 InterPro:IPR000529 LENGTH 156 SQ:AASEQ MRHYEVVFLVHPDQSEQLSAMMDRYRQIIETDGGCIHRLEDWGRRQLAYPIQKLYKAHYVLMNIECTPRTIEELTSAFRFNDAVLRDMVIRREEAITETSPLAKGEESGGRGYDSARSGRDRDESGGRGYDGARPGRDEDESKENTDRDEQSEDSE GT:EXON 1|1-156:0| SW:ID RS6_NITOC SW:DE RecName: Full=30S ribosomal protein S6; SW:GN Name=rpsF; OrderedLocusNames=Noc_0220; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->156|RS6_NITOC|4e-76|100.0|156/156| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 114->132|dsarsgrdrdesggrgydg| BL:PDB:NREP 1 BL:PDB:REP 1->100|1vs5F|4e-36|65.0|100/100| RP:PDB:NREP 1 RP:PDB:REP 1->96|2bxjA|1e-31|28.1|96/98| RP:PFM:NREP 1 RP:PFM:REP 3->91|PF01250|1e-23|51.7|89/92|Ribosomal_S6| HM:PFM:NREP 1 HM:PFM:REP 2->91|PF01250|2.7e-34|40.0|90/92|Ribosomal_S6| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01250|IPR000529| GO:PFM GO:0005840|"GO:ribosome"|PF01250|IPR000529| GO:PFM GO:0006412|"GO:translation"|PF01250|IPR000529| GO:PFM GO:0019843|"GO:rRNA binding"|PF01250|IPR000529| RP:SCP:NREP 1 RP:SCP:REP 1->100|1vs5F1|2e-32|65.0|100/100|d.58.14.1| HM:SCP:REP 1->104|1vmbA_|3e-33|44.2|104/0|d.58.14.1|1/1|Ribosomal protein S6| OP:NHOMO 624 OP:NHOMOORG 622 OP:PATTERN -------------------------------------------------------------------- 1-11111----11111111-111111111111111111111-1111111111111111--111111111111111111111111-1111111-111----------------------------------------1-1------1-11-111------------1----------------1--------111111111111111111111111111111-111------11-11111-11111111111-----1--1------1111-1---------------------------------------------------11111111111111111111111--1111--1111111111111111-1----111111111111111111111111111111111-11111111111112-11111111111111----------11111111111111-1------------1-11111111111-----11--1111111111111111111111111111111111111111111111111111111111111111111111111111-11---1----1111-1-11-------1--1-1-----1111111111-1-1-111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-----------------1-------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 64.7 SQ:SECSTR cEEEEEEEEEcTTccHHHHHHHHHHHHHHHTTTcEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEcHHHHHHHHHHHHTcTTEEEEEEEEcccccccccT####################################################### DISOP:02AL 96-156| PSIPRED cccccEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEccccccccccHHHccccEEEEEEEEEccHHHHHHHHHHHcccHHHEEEEEEEcccccccHHHHHccHHHccccccccccccccccccccccccccccccccHHHHHccccccccccc //