[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56773.1
DDBJ      :             LSU ribosomal protein L31P
Swiss-Prot:RL31_NITOC   RecName: Full=50S ribosomal protein L31;

Homologs  Archaea  0/68 : Bacteria  590/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.325.1
:68 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->66 1vs6Z PDBj 5e-23 59.1 %
:RPS:PDB   2->65 3bbo1 PDBj 9e-23 31.2 %
:RPS:SCOP  1->65 1vs6Z1  d.325.1.2 * 2e-27 60.0 %
:HMM:SCOP  1->70 1vs6Z1 d.325.1.2 * 4e-26 51.4 %
:RPS:PFM   1->64 PF01197 * Ribosomal_L31 3e-15 62.9 %
:HMM:PFM   1->66 PF01197 * Ribosomal_L31 5.3e-35 56.1 66/69  
:BLT:SWISS 1->68 RL31_NITOC 3e-38 100.0 %
:PROS 35->56|PS01143|RIBOSOMAL_L31

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56773.1 GT:GENE ABA56773.1 GT:PRODUCT LSU ribosomal protein L31P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 268174..268380 GB:FROM 268174 GB:TO 268380 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L31P GB:PROTEIN_ID ABA56773.1 GB:DB_XREF GI:76882092 InterPro:IPR002150 LENGTH 68 SQ:AASEQ MRQDIHPKYSEITVTCSCGNSFSTRSTAGKDFHIEVCSACHPFYTGKQKLLDTAGRVDKFRQRYNLKS GT:EXON 1|1-68:0| SW:ID RL31_NITOC SW:DE RecName: Full=50S ribosomal protein L31; SW:GN Name=rpmE; OrderedLocusNames=Noc_0243; SW:KW Complete proteome; Metal-binding; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->68|RL31_NITOC|3e-38|100.0|68/68| GO:SWS:NREP 5 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 35->56|PS01143|RIBOSOMAL_L31|PDOC00880| BL:PDB:NREP 1 BL:PDB:REP 1->66|1vs6Z|5e-23|59.1|66/70| RP:PDB:NREP 1 RP:PDB:REP 2->65|3bbo1|9e-23|31.2|64/72| RP:PFM:NREP 1 RP:PFM:REP 1->64|PF01197|3e-15|62.9|62/69|Ribosomal_L31| HM:PFM:NREP 1 HM:PFM:REP 1->66|PF01197|5.3e-35|56.1|66/69|Ribosomal_L31| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01197|IPR002150| GO:PFM GO:0005622|"GO:intracellular"|PF01197|IPR002150| GO:PFM GO:0005840|"GO:ribosome"|PF01197|IPR002150| GO:PFM GO:0006412|"GO:translation"|PF01197|IPR002150| RP:SCP:NREP 1 RP:SCP:REP 1->65|1vs6Z1|2e-27|60.0|65/70|d.325.1.2| HM:SCP:REP 1->70|1vs6Z1|4e-26|51.4|70/0|d.325.1.2|1/1|L28p-like| OP:NHOMO 605 OP:NHOMOORG 592 OP:PATTERN -------------------------------------------------------------------- 1111111-11111111111-1111111111111111122111-11122111111-111112212212111112221111111--1111--------1--------1111----------------111111111-111111111-1111-111--1111-11111-1111-111111111111---11111111---------------111111---111-1--------11--------------------1---------------------------------------------------------------------111111111111111111111111-1111111111111111111111-1--11111-------------------------------------------------1-------1------------111111111--1-111----------------------------------------111111111111111111111111111111111-----1-----11111111111111111-111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111-111111111-1-1-11-1111111111111111111111111111111111111111111111111-11111111111111111111111-1111111111111111111111111111111---111111111111111-11111111111111111111111111111-1-11---11111111111111111-1---11-11111--1111--11111--11----1111111111-1 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 66 STR:RPRED 97.1 SQ:SECSTR ccTTTcccccHHHHHcccccTTTccccccccccccccccccccccccccccccccccccccccccT## DISOP:02AL 66-68| PSIPRED cccccccccEEEEEEEccccEEEEEEEEccEEEEEEccccccEEcccEEEEEcccHHHHHHHHHcccc //