[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56785.1
DDBJ      :             aminodeoxychorismate synthase, subunit I
Swiss-Prot:             

Homologs  Archaea  58/68 : Bacteria  768/915 : Eukaryota  124/199 : Viruses  1/175   --->[See Alignment]
d.161.1
:471 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->461 1k0eA PDBj e-108 47.2 %
:RPS:PDB   42->459 3bznA PDBj e-116 21.0 %
:RPS:SCOP  9->459 1qdlA  d.161.1.1 * e-129 34.5 %
:HMM:SCOP  6->459 1i7qA_ d.161.1.1 * 7.9e-142 43.4 %
:RPS:PFM   19->147 PF04715 * Anth_synt_I_N 3e-17 35.7 %
:RPS:PFM   198->451 PF00425 * Chorismate_bind 2e-76 55.1 %
:HMM:PFM   198->451 PF00425 * Chorismate_bind 5.3e-101 49.2 252/257  
:HMM:PFM   14->151 PF04715 * Anth_synt_I_N 1.9e-31 31.9 135/140  
:BLT:SWISS 4->459 PABB_SALTY e-118 49.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56785.1 GT:GENE ABA56785.1 GT:PRODUCT aminodeoxychorismate synthase, subunit I GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(280895..282310) GB:FROM 280895 GB:TO 282310 GB:DIRECTION - GB:PRODUCT aminodeoxychorismate synthase, subunit I GB:PROTEIN_ID ABA56785.1 GB:DB_XREF GI:76882104 InterPro:IPR005801 InterPro:IPR005802 InterPro:IPR006805 LENGTH 471 SQ:AASEQ MKYSPRYAELPYSEDSAPLFEAIRQEPWAIFLDSGWPVNQSGRFDILAADPFMTFSCWGSETTIRKRHEAFSSLENPFILLQSELRRYTRNPSSIFPELPLTGGAMGYFGYDLGRRIEQLPTLALDMEGMPEMAIGLYDWVIVVDHRQQRSLLVGQGYDYRTWERWEALQSHLSQCHDSAPSQTTFRLWEPIESNLKQKDYQQAFTSIQHYIREGDCYQVNLAQRFEALAQGDPWALYRRLRLLNAAPFSAYFAIPEGAVLSTSPERFLRTNAGGVESHPIKGTRPRNPDPIADRKLALELQNSPKDRAENVMIVDLLRNDLGRVCLPGAIHVPRLCAIESFATVHHLVSTIRGRLTPGRDSIDLLQACFPGGSVTGAPKVRAMEIIEELEPHRRGVYCGSLGYIGFDGNMDTNIAIRTLVYSQSYLRFWAGGGIVADSVEEVEYQETLDKAAAILQALSEYTAPVSNRVP GT:EXON 1|1-471:0| BL:SWS:NREP 1 BL:SWS:REP 4->459|PABB_SALTY|e-118|49.8|446/454| SEG 239->244|rrlrll| BL:PDB:NREP 1 BL:PDB:REP 4->461|1k0eA|e-108|47.2|434/437| RP:PDB:NREP 1 RP:PDB:REP 42->459|3bznA|e-116|21.0|409/430| RP:PFM:NREP 2 RP:PFM:REP 19->147|PF04715|3e-17|35.7|126/140|Anth_synt_I_N| RP:PFM:REP 198->451|PF00425|2e-76|55.1|254/258|Chorismate_bind| HM:PFM:NREP 2 HM:PFM:REP 198->451|PF00425|5.3e-101|49.2|252/257|Chorismate_bind| HM:PFM:REP 14->151|PF04715|1.9e-31|31.9|135/140|Anth_synt_I_N| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF04715|IPR006805| GO:PFM GO:0016833|"GO:oxo-acid-lyase activity"|PF04715|IPR006805| RP:SCP:NREP 1 RP:SCP:REP 9->459|1qdlA|e-129|34.5|406/415|d.161.1.1| HM:SCP:REP 6->459|1i7qA_|7.9e-142|43.4|447/517|d.161.1.1|1/1|ADC synthase| OP:NHOMO 2331 OP:NHOMOORG 951 OP:PATTERN 11-1--1111111111-112222143323333111111111111111111111111--1--111--11 1111333333343344445-4333444444443323445524242131332233333322222144634341111211-11-32222222221211-1121222222332--------------133333323333222221113253533332233333233333245423333222333332222221-334444444443444444224434444233343333333322133333233333333332331----------21-------12-33311111112112222222222211111111111112--222----22-12----------111111111-1-121112443111--222112-112222222-----222112221121133233333332-22222222222-2222222222222222211322222222222222212212123-----------------------------22222222222233333322222222333323322222222222222221222332222222422222222111222-3223122222222-122222222222244222122-22222122222222222122224432232222333333333333333333331-12232-1---164443424455455544-4444445455455444444445445534444444444444444444433342-4444443343432212221122222223333332332333332333334323222326766332422222233222222222223335444444334433222222223222222-222222--------------------------------------1--1-111232 11----1-1---2222222233325352222222222222222222222223232222233322222212222222212222222222-22222222222232222-13-------------------------------------------------1----------------3133M3224254472731342222 --1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 459 STR:RPRED 97.5 SQ:SECSTR ###ccEEEEEcccTTHHHHHTTTTTcTTcEEEEcTTcccTTHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccHHHHHHHcccccEEEEEEEEEcTTccEEEEEEEEEEEEccHHHHHHHHHTcTTcTTccEEEEEcccTTcEEEEEEEEEEEEETTEEEHHHHHHHHTcccccccccccccEEEEEEEccHHHHHHHHHHHHHHHTTTcccEEEEEEEEEEEEcccccHHHHHHHHHcTTcEEEEEEEETTEEEEEEccEEEEEETTEEEEEEEEEEEEccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHTTccccEEcccEEEEEEEcccEEEEEEEEEEEccccccHHHHHHHHcccTTTcEEcHHHHHHHHHHHcccccTTTTcEEEEEccTcEEEEEEcccEEEEETTEEEEEEEEEEcTTccHHHHHHHHHHHHHHHHTTTTcE######### DISOP:02AL 465-471| PSIPRED cEEEEEEEEEcccccHHHHHHHHHccccEEEEEEcccccccccEEEEEEccEEEEEEEccEEEEEEcccEEEEcccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEEccEEEEEEEcccEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEccccHHHHHHHHHHHccccEEEEEEccccEEEEEccEEEEEEEccEEEEEEccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccEEEccccEEEEcccEEEEEEEEEEEEcccccHHHHHHHHccccccccccHHHHHHHHHHHcccccccEEEEEEEEcccccEEEEEEEEEEEEEccEEEEEEcEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccccccc //