[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56795.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:233 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   164->187 PF11118 * DUF2627 0.00059 37.5 24/77  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56795.1 GT:GENE ABA56795.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 293763..294464 GB:FROM 293763 GB:TO 294464 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56795.1 GB:DB_XREF GI:76882114 LENGTH 233 SQ:AASEQ MVTATMHSREKRLERALVGGAITAAASGVAAVILSILGLVHIGPLLMTPIAAIVIGAGLLSESGTLAAEYSEILSKTRRNRWRKVEFGSGASAEMLAGIAVITLGILSLLNLQPLVLLPVSVITLGACLLLSTGAKALLNSMRLEIPENHRRAEMVAHTTLRGAIWVQVIVGLAAIVLGILALAGWVPLILTLVAMLAIGASILLTGAAVSARMLSAYTAHTPPKGISHRSSI GT:EXON 1|1-233:0| TM:NTM 5 TM:REGION 14->36| TM:REGION 40->62| TM:REGION 103->125| TM:REGION 165->187| TM:REGION 195->217| SEG 18->36|vggaitaaasgvaavilsi| SEG 107->122|lsllnlqplvllpvsv| SEG 169->185|vivglaaivlgilalag| HM:PFM:NREP 1 HM:PFM:REP 164->187|PF11118|0.00059|37.5|24/77|DUF2627| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 227-233| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcEEccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //