[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56804.1
DDBJ      :             CsbD-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  168/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.60.11
:68 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->63 1jygA PDBj 2e-16 50.8 %
:RPS:SCOP  4->68 1rykA  a.60.11.1 * 9e-10 47.7 %
:HMM:SCOP  3->68 1rykA_ a.60.11.1 * 2.3e-22 56.1 %
:HMM:PFM   6->58 PF05532 * CsbD 7.4e-21 41.5 53/53  
:BLT:SWISS 3->68 Y4217_RHOPA 4e-19 48.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56804.1 GT:GENE ABA56804.1 GT:PRODUCT CsbD-like protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 303911..304117 GB:FROM 303911 GB:TO 304117 GB:DIRECTION + GB:PRODUCT CsbD-like protein GB:PROTEIN_ID ABA56804.1 GB:DB_XREF GI:76882123 InterPro:IPR008462 LENGTH 68 SQ:AASEQ MPINWDQIEGNWKQFKGHARQKWGKLTDDEIDEAAGNKQILAGKIQERYGIEREEAEKQVEEFRNSLK GT:EXON 1|1-68:0| BL:SWS:NREP 1 BL:SWS:REP 3->68|Y4217_RHOPA|4e-19|48.5|66/66| BL:PDB:NREP 1 BL:PDB:REP 3->63|1jygA|2e-16|50.8|61/69| HM:PFM:NREP 1 HM:PFM:REP 6->58|PF05532|7.4e-21|41.5|53/53|CsbD| RP:SCP:NREP 1 RP:SCP:REP 4->68|1rykA|9e-10|47.7|65/69|a.60.11.1| HM:SCP:REP 3->68|1rykA_|2.3e-22|56.1|66/69|a.60.11.1|1/1|Hypothetical protein YjbJ| OP:NHOMO 179 OP:NHOMOORG 170 OP:PATTERN -------------------------------------------------------------------- --2----------------------------------------------------------------------------------------------------1--------------------1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------1-1--32-1-111----------1------1--111--11111111111-1---121111111----------------1-----------------------------------111111-1111-----1111------1-11111--11--1111111-1-1--11-2---------1221--1-------------------------------------------------------------1-1--11-----------------------1---------11---111111111-11-111111111111111111111111--1111111111111111111111111--1--------------------------11-----------------------121--1111----1--------------------------------1111111111--------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 95.6 SQ:SECSTR ##cccccTTcTHHHHHHHHHHHTccccHHHHHHHTTcHHHHHHHHHHHccccHHHHHHHHHHHHHTc# DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcc //