[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56817.1
DDBJ      :             DNA polymerase III chi subunit, HolC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  256/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.128.1
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->138 1em8A PDBj 1e-11 28.3 %
:RPS:SCOP  1->141 1em8A  c.128.1.1 * 4e-33 30.5 %
:HMM:SCOP  1->142 1em8A_ c.128.1.1 * 3.4e-42 44.4 %
:RPS:PFM   1->139 PF04364 * DNA_pol3_chi 1e-30 48.1 %
:HMM:PFM   1->138 PF04364 * DNA_pol3_chi 9.4e-48 43.0 135/137  
:BLT:SWISS 1->141 HOLC_PSEAE 3e-31 43.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56817.1 GT:GENE ABA56817.1 GT:PRODUCT DNA polymerase III chi subunit, HolC GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(315513..315944) GB:FROM 315513 GB:TO 315944 GB:DIRECTION - GB:PRODUCT DNA polymerase III chi subunit, HolC GB:PROTEIN_ID ABA56817.1 GB:DB_XREF GI:76882136 InterPro:IPR007459 LENGTH 143 SQ:AASEQ MTKVDFYLLTSRQPQASKRFTCKLIEKVYRLGHQVYIQVEDQAQAQEMDDLLWTFRQGSFVPHALVNSEEATGTPVLIGYDGEPGGKLELLINLGAEVPAFFSRFQRVAEVIGPDETHRHAGRQRYRYYRDHGCSLETHELNF GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 1->141|HOLC_PSEAE|3e-31|43.9|139/142| BL:PDB:NREP 1 BL:PDB:REP 1->138|1em8A|1e-11|28.3|138/147| RP:PFM:NREP 1 RP:PFM:REP 1->139|PF04364|1e-30|48.1|135/137|DNA_pol3_chi| HM:PFM:NREP 1 HM:PFM:REP 1->138|PF04364|9.4e-48|43.0|135/137|DNA_pol3_chi| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF04364|IPR007459| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF04364|IPR007459| GO:PFM GO:0006260|"GO:DNA replication"|PF04364|IPR007459| RP:SCP:NREP 1 RP:SCP:REP 1->141|1em8A|4e-33|30.5|141/147|c.128.1.1| HM:SCP:REP 1->142|1em8A_|3.4e-42|44.4|142/147|c.128.1.1|1/1|DNA polymerase III chi subunit| OP:NHOMO 258 OP:NHOMOORG 257 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------1---1111111111111111111111111111111111111--1111111111111111111111111111---------------------------------------------------------111111111111111111111111111111111-11111------12111111111111111-1111111111111111111111111111111111111111111111111111-1111111111111-11-----11111111-111111111111111----------1111111111111111111---------1111-1111111111111-1--1111111----------------------------------------------------------- -1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 96.5 SQ:SECSTR cEEEEEEEcccccccHHHHHHHHHHHHHHHTTccEEEEcccHHHHHHHHHHHHHccTTccccEEETTcccTTcccEEEEcTTcccccccEEEEccccccGGGGGccEEEEEEcccHHHHHHHHHHHHHHHHTTEEEEE##### DISOP:02AL 142-143| PSIPRED ccEEEEEEEccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHcccccHHccccccccccccccccEEEEcccccccccEEEEEEcccccHHHcccEEEEEEEcccHHHHHHHHHHHHHHHHccccccEEEccc //