[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56835.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 25->67 MED16_XENLA 8e-04 30.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56835.1 GT:GENE ABA56835.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 334831..335142 GB:FROM 334831 GB:TO 335142 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56835.1 GB:DB_XREF GI:76882154 LENGTH 103 SQ:AASEQ MTDVDFVPTKPHQPGEFSLQGVFWAGHDLARKALGWVSPSTRIISPPTEGRSRSWQQGKYTANCWRNASHAGPRARSKVSLRLSACGHARAGTLTGGSFNIHV GT:EXON 1|1-103:0| BL:SWS:NREP 1 BL:SWS:REP 25->67|MED16_XENLA|8e-04|30.2|43/100| OP:NHOMO 6 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------6----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 49-54| PSIPRED ccccccccccccccccEEEEEEEEccHHHHHHHHcccccccEEEcccccccccccccccEEEcccccccccccccccEEEEEEEccccccccEEcccEEEEEc //