[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56842.1
DDBJ      :             diaminopimelate decarboxylase
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  799/915 : Eukaryota  182/199 : Viruses  1/175   --->[See Alignment]
b.49.2c.1.6
:417 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->406 2p3eB PDBj 4e-94 46.6 %
:RPS:PDB   19->413 3c5qA PDBj 5e-87 43.2 %
:RPS:SCOP  36->282 1hkvA2  c.1.6.1 * 4e-56 32.1 %
:RPS:SCOP  263->408 1knwA1  b.49.2.3 * 5e-36 37.0 %
:HMM:SCOP  27->283 1twiA2 c.1.6.1 * 3.4e-85 47.3 %
:HMM:SCOP  253->416 1knwA1 b.49.2.3 * 6.6e-56 50.9 %
:RPS:PFM   43->280 PF02784 * Orn_Arg_deC_N 3e-50 50.2 %
:RPS:PFM   274->391 PF00278 * Orn_DAP_Arg_deC 7e-10 36.8 %
:HMM:PFM   36->282 PF02784 * Orn_Arg_deC_N 9.4e-74 39.7 242/251  
:HMM:PFM   285->391 PF00278 * Orn_DAP_Arg_deC 6.8e-20 29.0 107/116  
:BLT:SWISS 2->416 DCDA_PSEAE e-154 65.2 %
:PROS 58->76|PS00878|ODR_DC_2_1
:PROS 226->242|PS00879|ODR_DC_2_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56842.1 GT:GENE ABA56842.1 GT:PRODUCT diaminopimelate decarboxylase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 340167..341420 GB:FROM 340167 GB:TO 341420 GB:DIRECTION + GB:PRODUCT diaminopimelate decarboxylase GB:PROTEIN_ID ABA56842.1 GB:DB_XREF GI:76882161 InterPro:IPR000183 InterPro:IPR002986 LENGTH 417 SQ:AASEQ MMEYFHYRYNVLWAEEIPLPEIASRFDTPCYVYSRAAIEHQWRAFDQAFEKHPHQICYAVKANSNLAVLNILARLGSGFDIVSVGELERVLAAGGDPGRIVFSGVGKRADEMERALAVGIACFNVESEAELIRLNEIAGKLEQRAPVSLRVNPDVDARTHPYIATGLRDNKFGIEIDQALAVYARAATLPHIDILGVDCHIGSQLTSLSPFLAALERVLALVDQLAERGIKIRHIDLGGGLGIIYRDEAPPSPQQYAAALRQKLAGRNLEIWIEPGRAIVGNGGVLLTRIEYLKQAPQKNFAIVDAAMNDLLRPALYDAWQEIIPVAVDATGEPLFFDVVGPVCETGDFLGKRRQLAIEAGDLLVVRAAGAYGFTMSSNYNSRPRAAEIMVDGAEAHLVRERETVESLYRGEATLPG GT:EXON 1|1-417:0| BL:SWS:NREP 1 BL:SWS:REP 2->416|DCDA_PSEAE|e-154|65.2|414/415| PROS 58->76|PS00878|ODR_DC_2_1|PDOC00685| PROS 226->242|PS00879|ODR_DC_2_2|PDOC00685| BL:PDB:NREP 1 BL:PDB:REP 4->406|2p3eB|4e-94|46.6|384/403| RP:PDB:NREP 1 RP:PDB:REP 19->413|3c5qA|5e-87|43.2|389/394| RP:PFM:NREP 2 RP:PFM:REP 43->280|PF02784|3e-50|50.2|233/249|Orn_Arg_deC_N| RP:PFM:REP 274->391|PF00278|7e-10|36.8|117/139|Orn_DAP_Arg_deC| HM:PFM:NREP 2 HM:PFM:REP 36->282|PF02784|9.4e-74|39.7|242/251|Orn_Arg_deC_N| HM:PFM:REP 285->391|PF00278|6.8e-20|29.0|107/116|Orn_DAP_Arg_deC| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02784|IPR000183| GO:PFM GO:0003824|"GO:catalytic activity"|PF00278|IPR000183| RP:SCP:NREP 2 RP:SCP:REP 36->282|1hkvA2|4e-56|32.1|246/265|c.1.6.1| RP:SCP:REP 263->408|1knwA1|5e-36|37.0|146/174|b.49.2.3| HM:SCP:REP 27->283|1twiA2|3.4e-85|47.3|256/0|c.1.6.1|1/1|PLP-binding barrel| HM:SCP:REP 253->416|1knwA1|6.6e-56|50.9|163/0|b.49.2.3|1/1|Alanine racemase C-terminal domain-like| OP:NHOMO 1645 OP:NHOMOORG 1017 OP:PATTERN -----------------1-----11--111111111111111122111112221---1---1111--- 1111311111111122211-11111211111111113211122111111111111112--321132444311111111112212221111121112-11111-1121111---------------1111111112111111111111111111111111211111111121111111111111211--1111111111111121111111211111111111111111111211222222222222221111111--1111-1-111111-11111111-------11111111111111-------------111111111111-11111111111132112111111--1221111121111111121--1122111122222222232222223222222222222-3323333233213333222222222232222312111222222222222221342---11111---------------------1334321111111112112221113122221212211221111211211112211112211111111111134322314311112121333122212111111112211111111111111111111111122111222121311222222232122222212211-1-222211111111331111111111111-1111111111111111111111113322222222222222222111111112-11112111112111-21211111112121311111111111111111131122313122323322233322344212123221211111111122222223333333322221111111111--------1-1-------------------------2232222222121 ----333-2111111121-13323141111111111222212111121111212-1112111111111111111111-1111111111-12121-1111-111112-312236641612--132751A19F413361-2-52263222223225142155781522-254121581232P2221421251221164452 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- STR:NPRED 416 STR:RPRED 99.8 SQ:SECSTR HHEcEEEccTTccHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHTccccEEEEEEGGGcccHHHHHHHHHTTcEEEEccHHHHHHHHHHTccGGGEEEccTTccHHHHHHHHHTTccEEEEccHHHHHHHHHHHHHHTccEEEEEEccccccccccGGGccccTTccccccHHHHHHHHHHHHHcTTEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHTTccccEEEccccccccTTccccccHHHHHHHHHHHTTTcccEEEEcccHHHHTTTEEEEEEEEEEEccccccEEEEcccTTTccHHHHHcccccEEEccccccccEEEEEEEcccccTTcEEEEEEEEcccTTcEEEEcccccccGGGcccTTTccccEEEEEccHcEEEEEccccHHHHHGGGTEEE# PSIPRED ccccEEEEccEEEEccccHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHcccEEEEcHHHHHHHHHccccHHEEEEccccccHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHccccccEEEccccccccccccccccHHHHHHHHHHHccccccEEEEccccEEEEccEEEEEEEEEEEEcccccEEEEccHHcccccHHHHccccccEEEccccccccEEEEEEEEEEccccEEEEEEEcccccccEEEEEcccHHHHHHccccccccccEEEEEEccEEEEEEccccHHHHHcccccccc //