[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56843.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:223 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->147 1g6q5 PDBj 5e-06 28.6 %
:RPS:PDB   31->206 3ckkA PDBj 5e-14 9.2 %
:RPS:SCOP  46->201 2p7hA1  c.66.1.41 * 3e-14 20.3 %
:HMM:SCOP  23->211 1kpiA_ c.66.1.18 * 8e-26 27.9 %
:RPS:PFM   30->117 PF01209 * Ubie_methyltran 6e-08 39.8 %
:HMM:PFM   49->138 PF08241 * Methyltransf_11 1.3e-13 30.6 85/95  
:BLT:SWISS 48->172 TAM_MYCA1 2e-09 36.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56843.1 GT:GENE ABA56843.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 341471..342142 GB:FROM 341471 GB:TO 342142 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA56843.1 GB:DB_XREF GI:76882162 InterPro:IPR000051 LENGTH 223 SQ:AASEQ MERIPEPELMDDETQARAYAEADFSEPNSRFIELLRGAFPSDALSGYVLDLGCGPGDITLRVARAWPSCIVHGVDGAAAMLHYGQRAVSEAGLKARVKFVHGRLPAVRLPREQYDVLISNSLLHHLLEPAILWDCLKRYGVRGAPVFIMDLRRPAARSEAAALVDQYAAEEPEILQRDFFNSLLAAFKPDELQEQLAQAGLNSLEVAVVSDRHLAISGFLTLS GT:EXON 1|1-223:0| BL:SWS:NREP 1 BL:SWS:REP 48->172|TAM_MYCA1|2e-09|36.3|113/260| BL:PDB:NREP 1 BL:PDB:REP 48->147|1g6q5|5e-06|28.6|98/321| RP:PDB:NREP 1 RP:PDB:REP 31->206|3ckkA|5e-14|9.2|174/196| RP:PFM:NREP 1 RP:PFM:REP 30->117|PF01209|6e-08|39.8|83/234|Ubie_methyltran| HM:PFM:NREP 1 HM:PFM:REP 49->138|PF08241|1.3e-13|30.6|85/95|Methyltransf_11| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01209|IPR004033| RP:SCP:NREP 1 RP:SCP:REP 46->201|2p7hA1|3e-14|20.3|148/229|c.66.1.41| HM:SCP:REP 23->211|1kpiA_|8e-26|27.9|183/0|c.66.1.18|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 38 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------1------------------------------------------------------------------------------------1-----1----111111111111--111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1------------------------------1--------------------------------------------------------------1--1------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------1-11--------------------------------------------------1-- ------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 223 STR:RPRED 100.0 SQ:SECSTR cGGHcGGGccGGGccEEEHHHTTTTTHHHHGcccTTTcTTcccEEcEEEEETcTTcHHHHHHGGGcTTcEEEEEEccHHHHHHHHHHHHHHHHcTTcccTTEEEEETTcHHHHccTTcEEEEEEEccccccHHHHHHHHEEEEEEEEEEEccHHHHHHHHHHHHTcTTEEEEcGGGGTTcTTGGGTTTccHHHHHHHHTTcccEEEEEETTEEEEETTHHHHT DISOP:02AL 1-2| PSIPRED ccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEccHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEEEEccccEEEEEEEEEcc //