[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56844.1
DDBJ      :             diaminopimelate epimerase
Swiss-Prot:DAPF_NITOC   RecName: Full=Diaminopimelate epimerase;         Short=DAP epimerase;         EC=5.1.1.7;

Homologs  Archaea  21/68 : Bacteria  715/915 : Eukaryota  25/199 : Viruses  0/175   --->[See Alignment]
d.21.1
:276 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->276 1gqzA PDBj 2e-70 52.9 %
:RPS:PDB   3->276 1bwzA PDBj 1e-69 48.9 %
:RPS:SCOP  3->132 1bwzA1  d.21.1.1 * 9e-37 53.1 %
:RPS:SCOP  135->276 1bwzA2  d.21.1.1 * 4e-48 45.8 %
:HMM:SCOP  1->276 1tm0A_ d.21.1.3 * 5.1e-58 29.2 %
:RPS:PFM   6->121 PF01678 * DAP_epimerase 6e-23 43.9 %
:HMM:PFM   5->125 PF01678 * DAP_epimerase 3.2e-36 40.3 119/121  
:HMM:PFM   154->269 PF01678 * DAP_epimerase 1e-30 33.9 115/121  
:BLT:SWISS 1->276 DAPF_NITOC e-151 100.0 %
:PROS 66->80|PS01326|DAP_EPIMERASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56844.1 GT:GENE ABA56844.1 GT:PRODUCT diaminopimelate epimerase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 342181..343011 GB:FROM 342181 GB:TO 343011 GB:DIRECTION + GB:PRODUCT diaminopimelate epimerase GB:PROTEIN_ID ABA56844.1 GB:DB_XREF GI:76882163 InterPro:IPR001653 LENGTH 276 SQ:AASEQ MRIAFTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGCDQVLLVTPASLPAIDFGYRIFNADGGEVEQCGNGARCFARFVREQGLTDKNVLRVQTASGIIELQLETDGQITVDMGVPRFAPHQIPFKVDQEADYYSLELDGQQVEIGAVSMGNPHCVLRVPAVDTAPVAHWGPLLESHPRFPQRVNVGFAQIVSPGHLRLRVYERGAGETPACGTGACAAAVIGKRRGWLSGQVNVDLPGGRLGIHWEGDGKSVWMSGPAEIVFKGSIEL GT:EXON 1|1-276:0| SW:ID DAPF_NITOC SW:DE RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase; EC=5.1.1.7; SW:GN Name=dapF; OrderedLocusNames=Noc_0316; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm; Isomerase;Lysine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->276|DAPF_NITOC|e-151|100.0|276/276| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0009085|"GO:lysine biosynthetic process"|Lysine biosynthesis| PROS 66->80|PS01326|DAP_EPIMERASE|PDOC01029| SEG 212->227|gagetpacgtgacaaa| BL:PDB:NREP 1 BL:PDB:REP 5->276|1gqzA|2e-70|52.9|272/274| RP:PDB:NREP 1 RP:PDB:REP 3->276|1bwzA|1e-69|48.9|274/274| RP:PFM:NREP 1 RP:PFM:REP 6->121|PF01678|6e-23|43.9|114/120|DAP_epimerase| HM:PFM:NREP 2 HM:PFM:REP 5->125|PF01678|3.2e-36|40.3|119/121|DAP_epimerase| HM:PFM:REP 154->269|PF01678|1e-30|33.9|115/121|DAP_epimerase| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF01678|IPR001653| GO:PFM GO:0008837|"GO:diaminopimelate epimerase activity"|PF01678|IPR001653| GO:PFM GO:0009089|"GO:lysine biosynthetic process via diaminopimelate"|PF01678|IPR001653| RP:SCP:NREP 2 RP:SCP:REP 3->132|1bwzA1|9e-37|53.1|130/130|d.21.1.1| RP:SCP:REP 135->276|1bwzA2|4e-48|45.8|142/144|d.21.1.1| HM:SCP:REP 1->276|1tm0A_|5.1e-58|29.2|264/332|d.21.1.3|1/1|Diaminopimelate epimerase-like| OP:NHOMO 798 OP:NHOMOORG 761 OP:PATTERN -----------------------1----1-1-11111111111111111----1-------------- 11111111111-1-11111-1-111111111111111-111111111-111111111---11111112111-11111-----111111111111--111111-1111111-1111111111111111111111111-----111--1111111111111111111112211111111111111-----111111111111111111111111111111111-1--11111121---------------------1--1--1-1-111111-----------------------------------------------------111111111111111-11111112-1--1111111111-11111111--111-111111111111111111111111111111111-111111111111111112111111111111111111111111111111111111111-11111----11111111111111111111111111111222211111111111-1111211111111111111111111111111111111111111111111111111111111111111111111111111211----1-111----------11111111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111121111111111111111111111111111111111111111111111111111111111121211111111111111111111111111111111212121211111---------111111111111111111111111111111111111111------------------------------------------1---111 ----421--------------------------------------------1--------------------------------------------------------1-------------------------------------------------2----21---------21111811111---2-1211----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 100.0 SQ:SECSTR EEcEEEEEEETTEEEEEEETTcccccccHHHHHHHHcTTTcccccEEEEEEccccTTccEEEEEEETTccccccTTTTHHHHHHHHHHTTcccccEEEEEccccEEEEEEcTTccEEEEcccccccGGGTTcccccccccEEEEETTEEEEEEEEEcccEEEEEEcccTTTccHHHHHHHHHTcTTcTTccEEEEEEEEETTEEEEEEEETTTEEccccHHHHHHHHHHHHHTTcccccEEEEccccEEEEEcccTTcccEEEEccEEEEEEEccc PSIPRED ccEEEEEEccccccEEEEccccccccccHHHHHHHHcccccccccEEEEEEccccccccEEEEEEEccccHHccccHHHHHHHHHHHHcccccccEEEEEEccEEEEEEEEcccEEEEEcccccccEEEccEEccccccEEEEEEccEEEEEEEEEccccEEEEEEcccccccHHHHHHHHHccccccccEEEEEEEEEcccEEEEEEEccccccccccHHHHHHHHHHHHHHcccccEEEEEccccEEEEEEEccccEEEEEEEEEEEEEEEEEc //